PRGDB00181472 (Si027373m)

From PRG Wiki
Jump to: navigation, search
Si027373m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Setaria italica

Comment?

receptor-like protein kinase 1 (best arabidopsis hit); S-locus lectin protein kinase family protein, putative (best rice hit)

DNA Sequence

ATGGCTATACCTGTACCCATCCGTCTGCTGTTGCTCGCACTCGCCACGCTTGCTTCCCTGCCCAGGTCAGGTGCGCAGACCAACGTCACCTTGGGGACCTCCCTGCCGGCCGCCGCCGGTGCCGCCTGGCCCTCCCCATCCGGCCGCTTCGCCTTCGGTTTCTACGCCACGGGCGGCGGCCTCGCCGTCGGCGTCTGGCTCGCCACATCGCCCAACGTGACCGTCACGTGGACGGCCGGCGGCGGCAACGACACGCCGGCCAACGGCGGCGAGCTCCAGCTCTCCGAAGACGGCCGCCTGCTCTGGACCGGCGCCGACGGCCAGTACAGAAGCCTCGCCGCTCCTCCCCAGCCGGCCCTCTCTGCGGCCATGCGCGACGACGGTAGCTTCGTGCTCTACGATGCCGACGGGGCCGTGGTGTGGTCCACGTTCGAGTTCCCCACGGACACCTTGGTCCCCGGTCAAGACCTCGTCCCTGGTGCGCACCTCTTCTCCAGCGTGTCGCCCACCAACAGGGCCGCCGGCAAGTTCCGCCTCGCCAACCAGCTCAACGACGAAAACCTCGTCTTGTACCCCGTGCAGACGGAGAACGCCGCGCACGCCGCGTACTGGGACACCGCCACGTTCCAGATCGGCTTCCCGCTCACCCTGCGCCTCGACGCCACCGGAGTGCTATACCTCACCGGCAACGGCGGCAACTACACCAAGAACCTCACGCGGCCCGGAGCCGCGCTGTCTCCCGCCGAGACGCAGGTCTTCTACCGCGTCACGCTCGACCCCGACGGAGTCTTGCGCCTGTACCGTCACGCCGTCGCGTCCGGCGACGCGTGGACGACCGACGTCCAGTTGATCGGCCCAAGCGACAGATGCCACGTCAAGGGCACGTGCGGGCCCAACAGCTACTGCGTCCTAGACCGCGACGCGCAGCCGAGCTGCCTTTGCCCTCCGGGGTTTGAATTCATCGATGCTGCCAACGGCGCGCTAGGGTGCACCAGGACCTCAGGCGCCGGCGACTGCGAGGCCGGTCTGTCCATGGCGACGATCCAGAACATGTCGTGGGCGGACACGTCGTACGCCGTGCTGGGCGCGGCCACCAGCGCCGCCGACTGCCAGGCCGCGTGCATGGCCGACTGCCTCTGCGCCGCCATGCTGCTCAACAGCAAAGACGGCACGTGCACTACGCAGCAGCTCCCTCTCATGTACGGCCGCACTGGCGGCGGCTACACGCTGTTCGTCAAGATCACCTCGGTGAGCCCGGCAATCGGCGGCGGCGGCAGGGGCCACCGCGTCGGGCGCACGACCATCGTCGTTGTGGTCTGCACCGGGCTCCTCGCGTGCGTGTCGTTAGCCGCGCTCCTGGCGGCGGCGCTGCTGTTCTGGGCGAACCGGAGGACGTTCGCGGAACAGGACGCGGCAGAGGCCCTGGACGAGGAGGCGCCCCTGAGGTCGTACAGCTACCAGGAACTGGAGCACGCAACGTGCGGCTTCCGCGAGCCGCTGGGCCGCGGCGCGTTCGGCACGGTGTTCCGGGGCACGCTGCTGCACAACAGCAGCGAGAAGACGATCGCCGTGAAGCGGCTGGACAAGGTGGTGGAGGAAGGGGAGGTGGAGTTCCAGCGGGAGGTGCGCGCCATCGGGCGGACGAGCCACCGGAACCTGGTCCGGCTGCTGGGGTTCTGCCACGAGGGCGCCAACCGGCTGCTGGTGTACGAGTACATGAGCAACGGGTCGCTGGCGGAGCGTCTGTTCAGGAGCGGCGGCGGTGACGGGCCGCCGGCGTGGGGCGAGCGGATGGGCATCGCGCTGGACGTCGCGCGCGGGCTGCACTACCTCCACGACGAGCTGGATAGCCGCGTGATCCACTGCGACGTGAAGCCGCAGAACATCCTGATGGACGCGTCGGGCACGGCCAAGATCGCCGACTTCGGGCTGGCCAAGCTGCTGCTGCCGGACCAGACGCGGACGTTCACGGGGGTGCGCGGCACGCGCGGGTACATGGCCCCGGAGTGGTACCGCGGCGTCGGGCCGCTGACGGTGAAGGCGGACGTGTACAGCTACGGCGTGGTGCTGCTGGAGATCGTGACGTGCCGGCGGAGCATGGAGCTGGAGGAGGCCGGCGAGGAGCGGACGCTCATGGAGTGCGCGCACGAGTGGCTAGTGCGGGGCGAGGTGACGCGGGCGGTGGGCTGCCAAGACGAGGCGCCGGAGGTGGAGCGGGCGGTGAAGGTGGCGGTGTGGTGCGCGCAGGCGGAGCCCCAGGCGAGGCCGGCCATGAGGAGCGTCATCCTGATGCTGGAAGGGCTCGTGGAG


Protein sequences

Name Description Sequence
Si027373m receptor-like protein kinase 1 (best arabidopsis hit); S-locus lectin protein kinase family protein, putative (best rice hit)

MAIPVPIRLLLLALATLASLPRSGAQTNVTLGTSLPAAAGAAWPSPSGRFAFGFYATGGGLAVGVWLATSPNVTVTWTAGGGNDTPANGGELQLSEDGRLLWTGADGQYRSLAAPPQPALSAAMRDDGSFVLYDADGAVVWSTFEFPTDTLVPGQDLVPGAHLFSSVSPTNRAAGKFRLANQLNDENLVLYPVQTENAAHAAYWDTATFQIGFPLTLRLDATGVLYLTGNGGNYTKNLTRPGAALSPAETQVFYRVTLDPDGVLRLYRHAVASGDAWTTDVQLIGPSDRCHVKGTCGPNSYCVLDRDAQPSCLCPPGFEFIDAANGALGCTRTSGAGDCEAGLSMATIQNMSWADTSYAVLGAATSAADCQAACMADCLCAAMLLNSKDGTCTTQQLPLMYGRTGGGYTLFVKITSVSPAIGGGGRGHRVGRTTIVVVVCTGLLACVSLAALLAAALLFWANRRTFAEQDAAEALDEEAPLRSYSYQELEHATCGFREPLGRGAFGTVFRGTLLHNSSEKTIAVKRLDKVVEEGEVEFQREVRAIGRTSHRNLVRLLGFCHEGANRLLVYEYMSNGSLAERLFRSGGGDGPPAWGERMGIALDVARGLHYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLLPDQTRTFTGVRGTRGYMAPEWYRGVGPLTVKADVYSYGVVLLEIVTCRRSMELEEAGEERTLMECAHEWLVRGEVTRAVGCQDEAPEVERAVKVAVWCAQAEPQARPAMRSVILMLEGLVE

Domains

Domain Start-End Description Sequence

Seg: seg
9-20 seg

LLLLALATLASL

ProfileScan: PS50927
IPR001480
28-145 BULB_LECTIN
Bulb-type lectin domain

NVTLGTSLPAAAGAAWPSPSGRFAFGFYATGGGLAVGVWLATSPNVTVTWTAGGGNDTPANGGELQLSEDGRLLWTGADGQYRSLAAPPQPALSAAMRDDGSFVLYDADGAVVWSTFE

Seg: seg
30-48 seg

TLGTSLPAAAGAAWPSPSG

HMMSmart: SM00108
IPR001480
34-147 Bulb-type mannose-specific lectin
Bulb-type lectin domain

SLPAAAGAAWPSPSGRFAFGFYATGGGLAVGVWLATSPNVTVTWTAGGGNDTPANGGELQLSEDGRLLWTGADGQYRSLAAPPQPALSAAMRDDGSFVLYDADGAVVWSTFEFP

HMMPanther: PTHR24420:SF847
43-770 OS03G0828800 PROTEIN

WPSPSGRFAFGFYATGGGLAVGVWLATSPNVTVTWTAGGGNDTPANGGELQLSEDGRLLWTGADGQYRSLAAPPQPALSAAMRDDGSFVLYDADGAVVWSTFEFPTDTLVPGQDLVPGAHLFSSVSPTNRAAGKFRLANQLNDENLVLYPVQTENAAHAAYWDTATFQIGFPLTLRLDATGVLYLTGNGGNYTKNLTRPGAALSPAETQVFYRVTLDPDGVLRLYRHAVASGDAWTTDVQLIGPSDRCHVKGTCGPNSYCVLDRDAQPSCLCPPGFEFIDAANGALGCTRTSGAGDCEAGLSMATIQNMSWADTSYAVLGAATSAADCQAACMADCLCAAMLLNSKDGTCTTQQLPLMYGRTGGGYTLFVKITSVSPAIGGGGRGHRVGRTTIVVVVCTGLLACVSLAALLAAALLFWANRRTFAEQDAAEALDEEAPLRSYSYQELEHATCGFREPLGRGAFGTVFRGTLLHNSSEKTIAVKRLDKVVEEGEVEFQREVRAIGRTSHRNLVRLLGFCHEGANRLLVYEYMSNGSLAERLFRSGGGDGPPAWGERMGIALDVARGLHYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLLPDQTRTFTGVRGTRGYMAPEWYRGVGPLTVKADVYSYGVVLLEIVTCRRSMELEEAGEERTLMECAHEWLVRGEVTRAVGCQDEAPEVERAVKVAVWCAQAEPQARPAMRSVILMLEGLVE

HMMPanther: PTHR24420
43-770 FAMILY NOT NAMED,FAMILY NOT NAMED

WPSPSGRFAFGFYATGGGLAVGVWLATSPNVTVTWTAGGGNDTPANGGELQLSEDGRLLWTGADGQYRSLAAPPQPALSAAMRDDGSFVLYDADGAVVWSTFEFPTDTLVPGQDLVPGAHLFSSVSPTNRAAGKFRLANQLNDENLVLYPVQTENAAHAAYWDTATFQIGFPLTLRLDATGVLYLTGNGGNYTKNLTRPGAALSPAETQVFYRVTLDPDGVLRLYRHAVASGDAWTTDVQLIGPSDRCHVKGTCGPNSYCVLDRDAQPSCLCPPGFEFIDAANGALGCTRTSGAGDCEAGLSMATIQNMSWADTSYAVLGAATSAADCQAACMADCLCAAMLLNSKDGTCTTQQLPLMYGRTGGGYTLFVKITSVSPAIGGGGRGHRVGRTTIVVVVCTGLLACVSLAALLAAALLFWANRRTFAEQDAAEALDEEAPLRSYSYQELEHATCGFREPLGRGAFGTVFRGTLLHNSSEKTIAVKRLDKVVEEGEVEFQREVRAIGRTSHRNLVRLLGFCHEGANRLLVYEYMSNGSLAERLFRSGGGDGPPAWGERMGIALDVARGLHYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLLPDQTRTFTGVRGTRGYMAPEWYRGVGPLTVKADVYSYGVVLLEIVTCRRSMELEEAGEERTLMECAHEWLVRGEVTRAVGCQDEAPEVERAVKVAVWCAQAEPQARPAMRSVILMLEGLVE

superfamily: SSF51110
IPR001480
60-210 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

GLAVGVWLATSPNVTVTWTAGGGNDTPANGGELQLSEDGRLLWTGADGQYRSLAAPPQPALSAAMRDDGSFVLYDADGAVVWSTFEFPTDTLVPGQDLVPGAHLFSSVSPTNRAAGKFRLANQLNDENLVLYPVQTENAAHAAYWDTATFQ

Gene3D: G3DSA:2.90.10.10
IPR001480
72-209 no description
Bulb-type lectin domain

NVTVTWTAGGGNDTPANGGELQLSEDGRLLWTGADGQYRSLAAPPQPALSAAMRDDGSFVLYDADGAVVWSTFEFPTDTLVPGQDLVPGAHLFSSVSPTNRAAGKFRLANQLNDENLVLYPVQTENAAHAAYWDTATF

HMMPfam: PF01453
IPR001480
73-160 B_lectin
Bulb-type lectin domain

VTVTWTAGGGNDTPANGGELQLSEDGRLLWTGADGQYRSLAAPPQPALSAAMRDDGSFVLYDADGAVVWSTFEFPTDTLVPGQDLVPG

Seg: seg
111-123 seg

SLAAPPQPALSAA

superfamily: SSF51110
IPR001480
184-279 alpha-D-mannose-specific plant lectins
Bulb-type lectin domain

NDENLVLYPVQTENAAHAAYWDTATFQIGFPLTLRLDATGVLYLTGNGGNYTKNLTRPGAALSPAETQVFYRVTLDPDGVLRLYRHAVASGDAWTT

HMMPfam: PF00954
IPR000858
248-319 S_locus_glycop
S-locus glycoprotein

AETQVFYRVTLDPDGVLRLYRHAVASGDAWTTDVQLIGPSDRCHVKGTCGPNSYCVLDRDAQPSCLCPPGFE

ProfileScan: PS50026
IPR000742
286-324 EGF_3
Epidermal growth factor-like domain

PSDRCHVKGTCGPNSYCVLDRDAQPSCLCPPGFEFIDAA

ProfileScan: PS50948
IPR003609
339-415 PAN
Apple-like

CEAGLSMATIQNMSWADTSYAVLGAATSAADCQAACMADCLCAAMLLNSKDGTCTTQQLPLMYGRTGGGYTLFVKIT

Seg: seg
363-384 seg

AATSAADCQAACMADCLCAAML

Seg: seg
422-442 seg

GGGGRGHRVGRTTIVVVVCTG

Seg: seg
443-461 seg

LLACVSLAALLAAALLFWA

Seg: seg
467-479 seg

AEQDAAEALDEEA

superfamily: SSF56112
IPR011009
468-765 Protein kinase-like (PK-like)
Protein kinase-like domain

EQDAAEALDEEAPLRSYSYQELEHATCGFREPLGRGAFGTVFRGTLLHNSSEKTIAVKRLDKVVEEGEVEFQREVRAIGRTSHRNLVRLLGFCHEGANRLLVYEYMSNGSLAERLFRSGGGDGPPAWGERMGIALDVARGLHYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLLPDQTRTFTGVRGTRGYMAPEWYRGVGPLTVKADVYSYGVVLLEIVTCRRSMELEEAGEERTLMECAHEWLVRGEVTRAVGCQDEAPEVERAVKVAVWCAQAEPQARPAMRSVILML

Gene3D: G3DSA:3.30.200.20
478-560 no description

EAPLRSYSYQELEHATCGFREPLGRGAFGTVFRGTLLHNSSEKTIAVKRLDKVVEEGEVEFQREVRAIGRTSHRNLVRLLGFC

HMMSmart: SM00220
IPR002290
494-769 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

CGFREPLGRGAFGTVFRGTLLHNSSEKTIAVKRLDKVVEEGEVEFQREVRAIGRTSHRNLVRLLGFCHEGANRLLVYEYMSNGSLAERLFRSGGGDGPPAWGERMGIALDVARGLHYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLLPDQTRTFTGVRGTRGYMAPEWYRGVGPLTVKADVYSYGVVLLEIVTCRRSMELEEAGEERTLMECAHEWLVRGEVTRAVGCQDEAPEVERAVKVAVWCAQAEPQARPAMRSVILMLEGLV

ProfileScan: PS50011
IPR000719
494-769 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

CGFREPLGRGAFGTVFRGTLLHNSSEKTIAVKRLDKVVEEGEVEFQREVRAIGRTSHRNLVRLLGFCHEGANRLLVYEYMSNGSLAERLFRSGGGDGPPAWGERMGIALDVARGLHYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLLPDQTRTFTGVRGTRGYMAPEWYRGVGPLTVKADVYSYGVVLLEIVTCRRSMELEEAGEERTLMECAHEWLVRGEVTRAVGCQDEAPEVERAVKVAVWCAQAEPQARPAMRSVILMLEGLV

HMMSmart: SM00219
IPR020635
496-765 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FREPLGRGAFGTVFRGTLLHNSSEKTIAVKRLDKVVEEGEVEFQREVRAIGRTSHRNLVRLLGFCHEGANRLLVYEYMSNGSLAERLFRSGGGDGPPAWGERMGIALDVARGLHYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLLPDQTRTFTGVRGTRGYMAPEWYRGVGPLTVKADVYSYGVVLLEIVTCRRSMELEEAGEERTLMECAHEWLVRGEVTRAVGCQDEAPEVERAVKVAVWCAQAEPQARPAMRSVILML

HMMPfam: PF00069
IPR000719
498-761 Pkinase,Ser-thr
Protein kinase, catalytic domain

EPLGRGAFGTVFRGTLLHNSSEKTIAVKRLDKVVEEGEVEFQREVRAIGRTSHRNLVRLLGFCHEGANRLLVYEYMSNGSLAERLFRSGGGDGPPAWGERMGIALDVARGLHYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLLPDQTRTFTGVRGTRGYMAPEWYRGVGPLTVKADVYSYGVVLLEIVTCRRSMELEEAGEERTLMECAHEWLVRGEVTRAVGCQDEAPEVERAVKVAVWCAQAEPQARPAMRSV

PatternScan: PS00107
IPR017441
500-525 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGAFGTVFRGTLLHNSSEKTIAVK

Gene3D: G3DSA:1.10.510.10
561-759 no description

HEGANRLLVYEYMSNGSLAERLFRSGGGDGPPAWGERMGIALDVARGLHYLHDELDSRVIHCDVKPQNILMDASGTAKIADFGLAKLLLPDQTRTFTGVRGTRGYMAPEWYRGVGPLTVKADVYSYGVVLLEIVTCRRSMELEEAGEERTLMECAHEWLVRGEVTRAVGCQDEAPEVERAVKVAVWCAQAEPQARPAMR

PatternScan: PS00108
IPR008271
619-631 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHCDVKPQNILM

Seg: seg
653-664 seg

TRTFTGVRGTRG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox