PRGDB00181473 (Si028297m)

From PRG Wiki
Jump to: navigation, search
Si028297m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Setaria italica

Comment?

NB-ARC domain-containing disease resistance protein (best arabidopsis hit); NB-ARC domain containing protein, putative, expressed (best rice hit)

DNA Sequence

ATGACACGATCTAACAGCCTCGCTGAGGATCCTAGCAGCCATGACCATCCTCTTCCTGCTAGTTCCAACAATGAGCTGCCACCCCAAGCAGCCGAGGCAGGTGGCTCTCGACCCCAAGCAGGCCACCCTATTGTCGGCATCGACCGCCCTACAAAGAAGCTTCTCAGGTGGCTCTCGCCCCTGGAGGGGACGGGCAAGAGGCTCAGAATCATGTCCATCGTCGGACCTACCGGCATGGGCAAGACGACACTTGCCTTGGAGCTCCGCAAATGGATCAGCTGCCAAGCAAGTGGAGGGCACCACTATTTCCAGTTCAACGTTATGGCCCAGGCGTCCCGGAGGGCCGATCGAAACGAGCTTCTTCTTCGAGACATCCTCTCACAGATTTCAGATCCAGCACCGGCAGGCGCGCCTGAGCCAACACAATCCATGCCATTGGAGCTGCTAGTTCCCCTTGTTTCGCAGCGCCTGCAAGATAAGAGATACTTCATCCTGATTGATGATATGTACATGCGGCGAGAATCGGATTGGGAGAAAATCAAGGGCGCGTTTCCTGATTATAATGTCGGGAGCCGAATACTGATCACAACACGCTTTCCAAGTATAGCATGGTTGTGTTGCTCTGATTCTGGTGGGCTTGTGCATGTGATGAAGCCTCTGAACAAGATGGATTCAAAAATGCTGCTTCTATTGAAAGCTTTTGGTTCTGTAGATGTTATGCTACCAGAAAATGTTAAGCTATATGCTGACAAAACCTTGATGAGATGTGAAGGTATACCATTGTTCCTAAGTGGCATGGCAGAATGCTTGAAGCAACAACTGCAACAGCAGCAGCAGCAGCAGGACCAACAACATCAAGAAGAGGCCGAGGATGAGGTGCATCAGAGAAATGGAATTTGTAGCGAGGAACAGGTCCCCCAGCTACCAAAACAGATCGAACAAGCACTAGCCTCTACTTTTGATGACATTCCTTATGAGTTGAGGTCACTATCATTGTACATGAGCATGTTTCCATATGGGTACAAGTTTGACAAGGACCGGCCCGTCATGAAATGGTTGTGTGAAGACCTTACAGATGATTGGGATGAGTGGCGCAATGTTGAAGATGCAGACGCAGAGAAGTACTTCTTCCAGCTAGTCGATACGAATGTCATCACCATGATGGCAGCAAGTTACAAAAGCAATCAGGATGAAGCCGAGGCCTCTCAGTGGCATGTGAATCATTTCATGCAGCAGTTCCTGGCCTCCAAATCAGCAGCGACAGGCTTTGCTTTCACCGGTGCCACACTCAATTTAGAAGCAGCATCAGCAACAGGCCATGGCAACAAAACCAGGATACGGCGGAGGCTTGCCGTCCACCATTCAGATCCCTGCCTCCCATCGCTGTTTGAAACAATTGACTTGTCTCAAACTCGTTCCCTAGCTGTGTCTGGTACGATCAGCAGAATTCCTTTCGATAAGTTTAATTTAGTAGTGCTGGATCTCGAAGGTTGGGAGAATTTGGAAGATGATGATCTACGGCAGGTATGCAGAAGCAAAATGTTCTTTCTACAGTATTTGAGTGTTAGGAATACTCAAGTAAAAAAGCTCCCAGATGAGATCAAGGAGCTGTGCAGTCTGATGATGTTGGATCTAAGAGGCACACAGATACGCCAGTTGCCCAAGCAAATTGTGGGGCTTCGCTCAACTTTGCGTGCTCTGCTCCTTGGTAGTGAAGGAATGATTAATCCCATTGCACCAGCGGGTGTACAACATTTGCACATGCTATCGACACTAGCCACCATTGATTTGAGTGAACAACCTGCAAGCTTCGTTGAGGCTCTCGGTGCTATGGAGAACTTGAGGGTGCTTGCAATAACATGGTCTTTTCACCAGTCTAGCGACGGAACCTACCGTGAAGCATTACGGTCATGTGTCAGAAAGTGGAAATGGCTCAAGTCGTTGACCATCCACTGTGGACTCGGGTGCTCCATGGAATTTCTGGGCGTACTGCCTGATCCTCCTCAGAATCTAGAGCAGTTCAAGGTGACAGCAGGAAGATTTGTAACTGTTCCCAAATGGATCAGGAATCTCCAATTTTTATCTTCCGTGCAAATCACCGTATGCAGACAAGACACAGATGATCTGAAGATACTCGGACACTTGATCAACTTGGAGTGTTTAGAACTACGCTTGGACTTCATTCCGGAAGAAGCTATAGTGATTGAAAGTGCAGGATCATTCCCTGAGCTTCAGAGGTTTTCTGTGGACTGCCCTGTGCCATGGCTCACTTTCAGAACAGGAGCTATGCGGAAGCTCGCATATCTTCAACTGAAATTCTTGTCTTGCCCGGCGAGCAGCCAGACTAGTGTTCCTTCAGGTATCGGCAGCCTCCAAAGTCTTACTGAGGTAGCCTTGTGCTACCACGAAAGGTACTCCGACAGCCCCAACGTCAAGGTGATAGAGAAGGTAGTGAGGGAAGCAGTTGCGGACCACGATAACCAGGTCGACCTGTTCATCAATGGTGTGCAATACTACGATGTTCAAGCAGCTGACGAGGAGACA


Protein sequences

Name Description Sequence
Si028297m NB-ARC domain-containing disease resistance protein (best arabidopsis hit); NB-ARC domain containing protein, putative, expressed (best rice hit)

MTRSNSLAEDPSSHDHPLPASSNNELPPQAAEAGGSRPQAGHPIVGIDRPTKKLLRWLSPLEGTGKRLRIMSIVGPTGMGKTTLALELRKWISCQASGGHHYFQFNVMAQASRRADRNELLLRDILSQISDPAPAGAPEPTQSMPLELLVPLVSQRLQDKRYFILIDDMYMRRESDWEKIKGAFPDYNVGSRILITTRFPSIAWLCCSDSGGLVHVMKPLNKMDSKMLLLLKAFGSVDVMLPENVKLYADKTLMRCEGIPLFLSGMAECLKQQLQQQQQQQDQQHQEEAEDEVHQRNGICSEEQVPQLPKQIEQALASTFDDIPYELRSLSLYMSMFPYGYKFDKDRPVMKWLCEDLTDDWDEWRNVEDADAEKYFFQLVDTNVITMMAASYKSNQDEAEASQWHVNHFMQQFLASKSAATGFAFTGATLNLEAASATGHGNKTRIRRRLAVHHSDPCLPSLFETIDLSQTRSLAVSGTISRIPFDKFNLVVLDLEGWENLEDDDLRQVCRSKMFFLQYLSVRNTQVKKLPDEIKELCSLMMLDLRGTQIRQLPKQIVGLRSTLRALLLGSEGMINPIAPAGVQHLHMLSTLATIDLSEQPASFVEALGAMENLRVLAITWSFHQSSDGTYREALRSCVRKWKWLKSLTIHCGLGCSMEFLGVLPDPPQNLEQFKVTAGRFVTVPKWIRNLQFLSSVQITVCRQDTDDLKILGHLINLECLELRLDFIPEEAIVIESAGSFPELQRFSVDCPVPWLTFRTGAMRKLAYLQLKFLSCPASSQTSVPSGIGSLQSLTEVALCYHERYSDSPNVKVIEKVVREAVADHDNQVDLFINGVQYYDVQAADEET

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
26-293 P-loop containing nucleoside triphosphate hydrolases

LPPQAAEAGGSRPQAGHPIVGIDRPTKKLLRWLSPLEGTGKRLRIMSIVGPTGMGKTTLALELRKWISCQASGGHHYFQFNVMAQASRRADRNELLLRDILSQISDPAPAGAPEPTQSMPLELLVPLVSQRLQDKRYFILIDDMYMRRESDWEKIKGAFPDYNVGSRILITTRFPSIAWLCCSDSGGLVHVMKPLNKMDSKMLLLLKAFGSVDVMLPENVKLYADKTLMRCEGIPLFLSGMAECLKQQLQQQQQQQDQQHQEEAEDEV

Gene3D: G3DSA:3.40.50.300
37-197 no description

RPQAGHPIVGIDRPTKKLLRWLSPLEGTGKRLRIMSIVGPTGMGKTTLALELRKWISCQASGGHHYFQFNVMAQASRRADRNELLLRDILSQISDPAPAGAPEPTQSMPLELLVPLVSQRLQDKRYFILIDDMYMRRESDWEKIKGAFPDYNVGSRILITT

HMMPanther: PTHR23155
44-846 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IVGIDRPTKKLLRWLSPLEGTGKRLRIMSIVGPTGMGKTTLALELRKWISCQASGGHHYFQFNVMAQASRRADRNELLLRDILSQISDPAPAGAPEPTQSMPLELLVPLVSQRLQDKRYFILIDDMYMRRESDWEKIKGAFPDYNVGSRILITTRFPSIAWLCCSDSGGLVHVMKPLNKMDSKMLLLLKAFGSVDVMLPENVKLYADKTLMRCEGIPLFLSGMAECLKQQLQQQQQQQDQQHQEEAEDEVHQRNGICSEEQVPQLPKQIEQALASTFDDIPYELRSLSLYMSMFPYGYKFDKDRPVMKWLCEDLTDDWDEWRNVEDADAEKYFFQLVDTNVITMMAASYKSNQDEAEASQWHVNHFMQQFLASKSAATGFAFTGATLNLEAASATGHGNKTRIRRRLAVHHSDPCLPSLFETIDLSQTRSLAVSGTISRIPFDKFNLVVLDLEGWENLEDDDLRQVCRSKMFFLQYLSVRNTQVKKLPDEIKELCSLMMLDLRGTQIRQLPKQIVGLRSTLRALLLGSEGMINPIAPAGVQHLHMLSTLATIDLSEQPASFVEALGAMENLRVLAITWSFHQSSDGTYREALRSCVRKWKWLKSLTIHCGLGCSMEFLGVLPDPPQNLEQFKVTAGRFVTVPKWIRNLQFLSSVQITVCRQDTDDLKILGHLINLECLELRLDFIPEEAIVIESAGSFPELQRFSVDCPVPWLTFRTGAMRKLAYLQLKFLSCPASSQTSVPSGIGSLQSLTEVALCYHERYSDSPNVKVIEKVVREAVADHDNQVDLFINGVQYYDVQAADE

HMMPanther: PTHR23155:SF86
44-846 OS11G0605100 PROTEIN,OS11G0605100 PROTEIN

IVGIDRPTKKLLRWLSPLEGTGKRLRIMSIVGPTGMGKTTLALELRKWISCQASGGHHYFQFNVMAQASRRADRNELLLRDILSQISDPAPAGAPEPTQSMPLELLVPLVSQRLQDKRYFILIDDMYMRRESDWEKIKGAFPDYNVGSRILITTRFPSIAWLCCSDSGGLVHVMKPLNKMDSKMLLLLKAFGSVDVMLPENVKLYADKTLMRCEGIPLFLSGMAECLKQQLQQQQQQQDQQHQEEAEDEVHQRNGICSEEQVPQLPKQIEQALASTFDDIPYELRSLSLYMSMFPYGYKFDKDRPVMKWLCEDLTDDWDEWRNVEDADAEKYFFQLVDTNVITMMAASYKSNQDEAEASQWHVNHFMQQFLASKSAATGFAFTGATLNLEAASATGHGNKTRIRRRLAVHHSDPCLPSLFETIDLSQTRSLAVSGTISRIPFDKFNLVVLDLEGWENLEDDDLRQVCRSKMFFLQYLSVRNTQVKKLPDEIKELCSLMMLDLRGTQIRQLPKQIVGLRSTLRALLLGSEGMINPIAPAGVQHLHMLSTLATIDLSEQPASFVEALGAMENLRVLAITWSFHQSSDGTYREALRSCVRKWKWLKSLTIHCGLGCSMEFLGVLPDPPQNLEQFKVTAGRFVTVPKWIRNLQFLSSVQITVCRQDTDDLKILGHLINLECLELRLDFIPEEAIVIESAGSFPELQRFSVDCPVPWLTFRTGAMRKLAYLQLKFLSCPASSQTSVPSGIGSLQSLTEVALCYHERYSDSPNVKVIEKVVREAVADHDNQVDLFINGVQYYDVQAADE

HMMPfam: PF00931
IPR002182
52-357 NB-ARC,NBS
NB-ARC

KKLLRWLSPLEGTGKRLRIMSIVGPTGMGKTTLALELRKWISCQASGGHHYFQFNVMAQASRRADRNELLLRDILSQISDPAPAGAPEPTQSMPLELLVPLVSQRLQDKRYFILIDDMYMRRESDWEKIKGAFPDYNVGSRILITTRFPSIAWLCCSDSGGLVHVMKPLNKMDSKMLLLLKAFGSVDVMLPENVKLYADKTLMRCEGIPLFLSGMAECLKQQLQQQQQQQDQQHQEEAEDEVHQRNGICSEEQVPQLPKQIEQALASTFDDIPYELRSLSLYMSMFPYGYKFDKDRPVMKWLCEDL

FPrintScan: PR00364
IPR000767
70-85 DISEASERSIST
Disease resistance protein

IMSIVGPTGMGKTTLA

FPrintScan: PR00364
IPR000767
156-170 DISEASERSIST
Disease resistance protein

RLQDKRYFILIDDMY

FPrintScan: PR00364
IPR000767
256-270 DISEASERSIST
Disease resistance protein

CEGIPLFLSGMAECL

Coil: coil
267-292 coiled-coil

AECLKQQLQQQQQQQDQQHQEEAEDE

Seg: seg
272-286 seg

QQLQQQQQQQDQQHQ

Seg: seg
419-429 seg

AATGFAFTGAT

superfamily: SSF52047
468-751 RNI-like,LRR

LSQTRSLAVSGTISRIPFDKFNLVVLDLEGWENLEDDDLRQVCRSKMFFLQYLSVRNTQVKKLPDEIKELCSLMMLDLRGTQIRQLPKQIVGLRSTLRALLLGSEGMINPIAPAGVQHLHMLSTLATIDLSEQPASFVEALGAMENLRVLAITWSFHQSSDGTYREALRSCVRKWKWLKSLTIHCGLGCSMEFLGVLPDPPQNLEQFKVTAGRFVTVPKWIRNLQFLSSVQITVCRQDTDDLKILGHLINLECLELRLDFIPEEAIVIESAGSFPELQRFSVDC

FPrintScan: PR00364
IPR000767
535-551 DISEASERSIST
Disease resistance protein

KELCSLMMLDLRGTQIR

Gene3D: G3DSA:3.80.10.10
682-724 no description

VTVPKWIRNLQFLSSVQITVCRQDTDDLKILGHLINLECLELR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox