PRGDB00181474 (Si025980m)

From PRG Wiki
Jump to: navigation, search
Si025980m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Setaria italica

Comment?

disease resistance family protein / LRR family protein (best arabidopsis hit); leucine rich repeat protein, putative, expressed (best rice hit)

DNA Sequence

ATGAACTCCTCCTTAGTTGGATTACAGCATCTGAAGTATTTAGACTTGAGTTGTAACAACTTCAATGGTTCAAGCATCCCAAAGTTTATTGGCTCCCTTAAAAGTCTTGAATACCTCAACCTTTCTAAGGCGGGATTTGGGGGGACAATACCTCCGCAGCTAGGTAACCTATCCAAGCTCGTCTATCTTGATCTTAATTTAAATTATGGGCGCTTGGGCTTTCTATACTCCGACAGCCTTACATGGGTGTCACATCTTTCCCTACTGAAATACCTTGACATGAGCGGGTTGCATCTTAGCGCCGCAGTAGACTGGATTCATGGAATTAGTAGCCTTCCGTCACTAGAAGTTCTTCATCTAAGTGACAGCGGTCTAAGAAACACAAATACCATTCTCAGCCACTCTAATCTAACAGCACTTAAGGTATTGGACATCAGATCAAACTACTTTCATACTGCAATTTCTCCCAATTGGTTTTGGAACATAAGGACATTGACTTATCTTGACCTCTCTTCATCTGGCTTCCAAGGCCCAATTCCTTATGAGATGGGAAATATGACCTCACTTGAGCAAGTCTATATAGGTGACAACAATATTATGAGTATGATACCACCGAATTTGGAGAACCTATGTAACTTGAAGATTATGGATTTTTCATGGAGTAATATCACTGGGGATATAGGTGATTTGATGAACAGGCTTCCAAAATGTTCATGGAACAAGCTGTACGTGTTGGATTTTTCCTATAACAATTTGGACGGGAACCTTCCAAATTGGTTACAGCCTCTAAAGAACCTGAGTTACTTAAATTTGCATGGTAACAATATCATGGGCCCTTTACCATTGTGGATAGGAGGGCTTCACAATTTGACTATATTAAATCTTGGTTCTAACCGGCTGGTTGGTGAAATAAATGAAGAGCACTTGGAAGCATTGACAAATTTACAAGTACTAGACATGTCTGATAACTCTCTTTCCATGAGGGTACACTCGAATTGGATTCCTTCATTCAAATTAAAGATGGCCGGTTTCAGGTCATGGCAGCTTGGACCTGCGTTCCCATCATGGATTAGATGGCAAAGGAGTATGAATGTTCTTGACATTTCAAATGCAACCATACATGACAATGTACCCGATTGGTTCTGGGTCGTAGTTTCAACAGCTTCCTATTTGAACATGTCAAATAATTTATTAAGTGGCACATTACCAGCAAGTCTTGAAATGCTGGCGGCAGGAATGATTGACCTTAGTAGTAACAGATTTGCAGGTCCAGTTCCACGTTTTCCCAGAAATGTACAGTATCTTGACCTCTCCAGAAACAATTTATCAGGAACACTACCAGACTTTGGAGCCATGAATTCATTTTATGCTTTGGCTCTTTACAACAATTCAATTTCTGGCAGTATACCATTTTCGCTGTGCCTCGTGCAATGTTTGAATATACTAGACCTATCAGGAAACATGTTATCAGGAGAGTTGCCCACTTGCAAAGGAGATTCTGGTCCGTACAAACAAATGCTTGCACTTAACTTAAATAGCAATAATCTTTCAGGAGTTTTCCCGTCAGCTCTTCAGATGTCCCAAGATTTAGTTTTCCTTGATCTTGCATATAACCAATTCTCTGGGAATTTGCCAGCATGGTTAGGAGATAAGTTGCCATCCCTAGCATTGCTACGACTGCGGTCCAATAACTTTTCTGGCAATATTCCCATTCAACTTGCAACGATTCAAGGGCTTCAATATATTGACCTTGCATGTAACCACATTTCTGGTCAAATACCTGAGTCCATAGTGAACTTGAAGACCACGTCAGTTCTAACCAAAGGGCAACAGCTTGAATTTACTAAAGGAATTCAGTACATGGTAAATATTGATTTATCATGTAACAATTTGACTGGACAAATTCCTCAAGGCATTAGTGCTCTGGTTGCTTTGAAAAGCTTGAATGTTTCTTGGAATCATTTAAGCGGGAGAATTCCCAATAACATTGGTGACCTCAAGGCATTGGAGTCCCTCGACTTATCACATAATGAGCTATCTGGAGAGATCCCTTCAAGCATATCAGCTCTAACTTCTTTGGCCAGCTTCAACCTCTCGTATAACAATCTAAGCGGAAGAATACCAACAGGGAATCAACTTCAGACGCTAGCAACTGATGACCCGGAATCAATGTATGTTGGAAACATTGGTTTATGTGGTCCTCCGCTACCAAAGGGGTGCCCTGGAAATGGAACAAGTAATTCTCCGGTTGATGAGCCTGAGCAGAAGGACAATGGGATGGTGAACTCCATCTACCTGAGCATGATTATCGGGTTCATCTTTGGCCTTTGGGTGGTGTTCTGCATTATGTTGTTACATAAGGGACTGAGGTATTCCTATTTCGCCTCCATTGATTACCTGTATCACACGATGTGCGTTCATGTGGTTGTCACTTGGAACTTCTTGATGAGAAGAGGGAATCGAGCAGGATTAGCTGCTTGA


Protein sequences

Name Description Sequence
Si025980m disease resistance family protein / LRR family protein (best arabidopsis hit); leucine rich repeat protein, putative, expressed (best rice hit)

MNSSLVGLQHLKYLDLSCNNFNGSSIPKFIGSLKSLEYLNLSKAGFGGTIPPQLGNLSKLVYLDLNLNYGRLGFLYSDSLTWVSHLSLLKYLDMSGLHLSAAVDWIHGISSLPSLEVLHLSDSGLRNTNTILSHSNLTALKVLDIRSNYFHTAISPNWFWNIRTLTYLDLSSSGFQGPIPYEMGNMTSLEQVYIGDNNIMSMIPPNLENLCNLKIMDFSWSNITGDIGDLMNRLPKCSWNKLYVLDFSYNNLDGNLPNWLQPLKNLSYLNLHGNNIMGPLPLWIGGLHNLTILNLGSNRLVGEINEEHLEALTNLQVLDMSDNSLSMRVHSNWIPSFKLKMAGFRSWQLGPAFPSWIRWQRSMNVLDISNATIHDNVPDWFWVVVSTASYLNMSNNLLSGTLPASLEMLAAGMIDLSSNRFAGPVPRFPRNVQYLDLSRNNLSGTLPDFGAMNSFYALALYNNSISGSIPFSLCLVQCLNILDLSGNMLSGELPTCKGDSGPYKQMLALNLNSNNLSGVFPSALQMSQDLVFLDLAYNQFSGNLPAWLGDKLPSLALLRLRSNNFSGNIPIQLATIQGLQYIDLACNHISGQIPESIVNLKTTSVLTKGQQLEFTKGIQYMVNIDLSCNNLTGQIPQGISALVALKSLNVSWNHLSGRIPNNIGDLKALESLDLSHNELSGEIPSSISALTSLASFNLSYNNLSGRIPTGNQLQTLATDDPESMYVGNIGLCGPPLPKGCPGNGTSNSPVDEPEQKDNGMVNSIYLSMIIGFIFGLWVVFCIMLLHKGLRYSYFASIDYLYHTMCVHVVVTWNFLMRRGNRAGLAA*


Domains

Domain Start-End Description Sequence

superfamily: SSF52047
1-326 RNI-like,LRR

MNSSLVGLQHLKYLDLSCNNFNGSSIPKFIGSLKSLEYLNLSKAGFGGTIPPQLGNLSKLVYLDLNLNYGRLGFLYSDSLTWVSHLSLLKYLDMSGLHLSAAVDWIHGISSLPSLEVLHLSDSGLRNTNTILSHSNLTALKVLDIRSNYFHTAISPNWFWNIRTLTYLDLSSSGFQGPIPYEMGNMTSLEQVYIGDNNIMSMIPPNLENLCNLKIMDFSWSNITGDIGDLMNRLPKCSWNKLYVLDFSYNNLDGNLPNWLQPLKNLSYLNLHGNNIMGPLPLWIGGLHNLTILNLGSNRLVGEINEEHLEALTNLQVLDMSDNSLS

Gene3D: G3DSA:3.80.10.10
3-235 no description

SSLVGLQHLKYLDLSCNNFNGSSIPKFIGSLKSLEYLNLSKAGFGGTIPPQLGNLSKLVYLDLNLNYGRLGFLYSDSLTWVSHLSLLKYLDMSGLHLSAAVDWIHGISSLPSLEVLHLSDSGLRNTNTILSHSNLTALKVLDIRSNYFHTAISPNWFWNIRTLTYLDLSSSGFQGPIPYEMGNMTSLEQVYIGDNNIMSMIPPNLENLCNLKIMDFSWSNITGDIGDLMNRLP

HMMSmart: SM00369
IPR003591
8-33 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQHLKYLDLSCNNFNGSSIPKFIGSL

HMMPfam: PF00560
IPR001611
10-29 LRR_1
Leucine-rich repeat

HLKYLDLSCNNFNGSSIPKF

HMMPanther: PTHR24420
39-709 FAMILY NOT NAMED,FAMILY NOT NAMED

LNLSKAGFGGTIPPQLGNLSKLVYLDLNLNYGRLGFLYSDSLTWVSHLSLLKYLDMSGLHLSAAVDWIHGISSLPSLEVLHLSDSGLRNTNTILSHSNLTALKVLDIRSNYFHTAISPNWFWNIRTLTYLDLSSSGFQGPIPYEMGNMTSLEQVYIGDNNIMSMIPPNLENLCNLKIMDFSWSNITGDIGDLMNRLPKCSWNKLYVLDFSYNNLDGNLPNWLQPLKNLSYLNLHGNNIMGPLPLWIGGLHNLTILNLGSNRLVGEINEEHLEALTNLQVLDMSDNSLSMRVHSNWIPSFKLKMAGFRSWQLGPAFPSWIRWQRSMNVLDISNATIHDNVPDWFWVVVSTASYLNMSNNLLSGTLPASLEMLAAGMIDLSSNRFAGPVPRFPRNVQYLDLSRNNLSGTLPDFGAMNSFYALALYNNSISGSIPFSLCLVQCLNILDLSGNMLSGELPTCKGDSGPYKQMLALNLNSNNLSGVFPSALQMSQDLVFLDLAYNQFSGNLPAWLGDKLPSLALLRLRSNNFSGNIPIQLATIQGLQYIDLACNHISGQIPESIVNLKTTSVLTKGQQLEFTKGIQYMVNIDLSCNNLTGQIPQGISALVALKSLNVSWNHLSGRIPNNIGDLKALESLDLSHNELSGEIPSSISALTSLASFNLSYNNLSGRIPT

HMMPfam: PF13855
113-173 LRR_8,Leucine rich repeat

PSLEVLHLSDSGLRNTNTILSHSNLTALKVLDIRSNYFHTAISPNWFWNIRTLTYLDLSSS

HMMSmart: SM00369
IPR003591
137-161 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTALKVLDIRSNYFHTAISPNWFWN

HMMSmart: SM00369
IPR003591
186-210 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

MTSLEQVYIGDNNIMSMIPPNLENL

Gene3D: G3DSA:3.80.10.10
240-496 no description

NKLYVLDFSYNNLDGNLPNWLQPLKNLSYLNLHGNNIMGPLPLWIGGLHNLTILNLGSNRLVGEINEEHLEALTNLQVLDMSDNSLSMRVHSNWIPSFKLKMAGFRSWQLGPAFPSWIRWQRSMNVLDISNATIHDNVPDWFWVVVSTASYLNMSNNLLSGTLPASLEMLAAGMIDLSSNRFAGPVPRFPRNVQYLDLSRNNLSGTLPDFGAMNSFYALALYNNSISGSIPFSLCLVQCLNILDLSGNMLSGELPTC

HMMSmart: SM00369
IPR003591
263-287 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKNLSYLNLHGNNIMGPLPLWIGGL

HMMPfam: PF13855
283-325 LRR_8,Leucine rich repeat

WIGGLHNLTILNLGSNRLVGEINEEHLEALTNLQVLDMSDNSL

HMMSmart: SM00369
IPR003591
312-336 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTNLQVLDMSDNSLSMRVHSNWIPS

superfamily: SSF52058
348-716 L domain-like,LRR

QLGPAFPSWIRWQRSMNVLDISNATIHDNVPDWFWVVVSTASYLNMSNNLLSGTLPASLEMLAAGMIDLSSNRFAGPVPRFPRNVQYLDLSRNNLSGTLPDFGAMNSFYALALYNNSISGSIPFSLCLVQCLNILDLSGNMLSGELPTCKGDSGPYKQMLALNLNSNNLSGVFPSALQMSQDLVFLDLAYNQFSGNLPAWLGDKLPSLALLRLRSNNFSGNIPIQLATIQGLQYIDLACNHISGQIPESIVNLKTTSVLTKGQQLEFTKGIQYMVNIDLSCNNLTGQIPQGISALVALKSLNVSWNHLSGRIPNNIGDLKALESLDLSHNELSGEIPSSISALTSLASFNLSYNNLSGRIPTGNQLQTL

HMMPfam: PF00560
IPR001611
431-451 LRR_1
Leucine-rich repeat

NVQYLDLSRNNLSGTLPDFGA

FPrintScan: PR00019
432-445 LEURICHRPT,Leucine-rich repeat signature

VQYLDLSRNNLSGT

Seg: seg
507-517 seg

LALNLNSNNLS

Gene3D: G3DSA:3.80.10.10
508-718 no description

ALNLNSNNLSGVFPSALQMSQDLVFLDLAYNQFSGNLPAWLGDKLPSLALLRLRSNNFSGNIPIQLATIQGLQYIDLACNHISGQIPESIVNLKTTSVLTKGQQLEFTKGIQYMVNIDLSCNNLTGQIPQGISALVALKSLNVSWNHLSGRIPNNIGDLKALESLDLSHNELSGEIPSSISALTSLASFNLSYNNLSGRIPTGNQLQTLAT

HMMPfam: PF00560
IPR001611
579-600 LRR_1
Leucine-rich repeat

LQYIDLACNHISGQIPESIVNL

HMMSmart: SM00369
IPR003591
642-665 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVALKSLNVSWNHLSGRIPNNIGD

HMMPfam: PF00560
IPR001611
645-665 LRR_1
Leucine-rich repeat

LKSLNVSWNHLSGRIPNNIGD

FPrintScan: PR00019
666-679 LEURICHRPT,Leucine-rich repeat signature

LKALESLDLSHNEL

HMMSmart: SM00369
IPR003591
666-690 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKALESLDLSHNELSGEIPSSISAL

HMMPfam: PF00560
IPR001611
669-690 LRR_1
Leucine-rich repeat

LESLDLSHNELSGEIPSSISAL

Seg: seg
730-742 seg

GLCGPPLPKGCPG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox