PRGDB00181475 (Si027691m)

From PRG Wiki
Jump to: navigation, search
Si027691m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR
Gene Species Setaria italica

Comment?

NB-ARC domain-containing disease resistance protein (best arabidopsis hit); resistance protein, putative, expressed (best rice hit)

DNA Sequence

ATGTCTGGTGCTGGTAAATCAGGACTCGTTTGGAACATCTACTGCAAATGGCGGACTAGTAATAATTCATGGAAGCACGCTTGGGCTAGTGTTTCCCATCCATTCAATCCCACAGACTTCTCCCGAAATTTACTTCTGCATTTACTTCCGAAATCAACTTCTTCGGAGGAAAGATATTATAAAGCACATCCGGCAAAAGATCCCATCCAAGAATGTCAACATCTTCTACATGAACATGTGTACCTAGTTGTAATTGATGGTTTGCAGTTCAAGGAAGACTGGGATTGGATAAAATCTAACTTGATAGGAAGCGGAGGTTTGAGAAGTTGTATCATCACCATTACTTCGGAAGAAAGTGTTGGCAAACATTGTGTAGTATCATCAAACAATGCAGTAGTGCACAATATCAAAGGTCTTGAAGCTGATGCAGCCCTTGAACTGTTCAAAAAGAAATGCATGCTTTATCTATCGGTCTTTCCTCAAGACAGGATCATCCGGAGGAGGCGTTTGGTGTGGCGGTGGATCGCGGAGGGCTACTCAAAGGGCACCGACAGCATTAGCATGGAGAAGTACGCGGAGAAGCTTTTTGACGAGGTTTCTGCACTGAGCATCATTCAGCCAGTACTGAAGGCAAGTAAGGTTATTGGGTACCGAGTCAATGGTTTCTTCCGCGAGTATATCATCTCGCGGCCGGTGGAAGAGAGAGTTTTCTTTCCAGTGGAAGTCTCTGCACTGGGGCGCGGGCATGGCCGGCTGACCACAGAAGGCATAGGACAGCACCTAGCTGTTGGGGATTCCTGGGATGTTGACCGGGTTGTGTTCGAGGGTTTGGACTTCTCACGGCTACGGTCTTTGACAGTGTTTAGAACAGTGTTTTGGCCATGGTACGTCCCGGACAGGATGAGGGTGCTTCGGGTGCTGGATCTAGAGAATGCAGAGTATGTAAGTAATTATGCCTTTGAGAAGATTATGAAGCTGCTGCCTCGTCTGAAGTTCCTCTCGCTAAGAGGACAGAGGGAAGTCTCGCGAGTGCCAGATTCCGTGGGTGAGCTGATGCAGCTGCAAACTCTGGATATCAGAGACACCTCTATAGTCGCGCTACCACCATGCATCACCCGGCTACAGAAGCTGCAGTACATTCGTGCAGGTACCACCATAGCGTTCACGCAAGATGACAGCTTGTCTGCGGGGGAGCATTCGACTCCATTGAGTAGGAGGTCAAACGCTATGGCGTCCCGCTTGCTTGCCAGATTCAGCAGACGTGGACCTGATGGCTCTTGCAGGAATGGTGTTGAGGTGCCAAGAGGGATCGAGAGACTGAAAGCCTTGCGGACGCTTGGTGCTATTGATGTAAATACTGCAGGGGATGCCACTCTTAGTGAGATCCGTTCCCTCTTTCGCCAGTTGAAGAAACTCGAATTATTCATGATCAACCGTAAAATCAGCGGATGGTTTTTGTCGCATTTATTTGTGGCACAGCATTTGGAATCATTGTCTATGCAGTTTGAGAAGAGCGATCATTTTGTTCATTGGGACTACATCTCCCTTCCCAGAAGCCTACGGAGCCTAAAGATGCACGGCCATGTAGAGCAGCTGCCACGAGGTATCGAGTATCTTGGTAATCTCTTGAAGCTGACTTTAGAGAAGACTACACTGTTCACACCAGATGACATAGAGGTCATCGGGACATTACGAAGTCTGCGTACTCTGCGCCTCCGTGTCAATAAAGATCAAGATGGCGAGCTCCAATATCACTCTAGCCTTTTCAGCAAACTCGAGGTCCTCGAGATTGTCTGCAAATCGAAGTTACGTGTAAGGTTTGACATTGATGCAATGGAAAAGCTTGAGCAGCTGAAGATTCACTGCCTTCAGGGGTCGGAGATGCAGTTCTCTGGGTTAGAGCACCTGTTTTCCCTCAAGCAAGTCTGGCTTATGGGTTCCATCGACGACGCACTCAAGGTAGCATTGGAGCAGCAACTTGTCAAGCATCTGAAGAAACCTGCTCCGAAACTGGAGGTTGAGCCACGTTCGTCCCAGGAGTCGTCCGAGGAGTCGAACTAA


Protein sequences

Name Description Sequence
Si027691m NB-ARC domain-containing disease resistance protein (best arabidopsis hit); resistance protein, putative, expressed (best rice hit)

MSGAGKSGLVWNIYCKWRTSNNSWKHAWASVSHPFNPTDFSRNLLLHLLPKSTSSEERYYKAHPAKDPIQECQHLLHEHVYLVVIDGLQFKEDWDWIKSNLIGSGGLRSCIITITSEESVGKHCVVSSNNAVVHNIKGLEADAALELFKKKCMLYLSVFPQDRIIRRRRLVWRWIAEGYSKGTDSISMEKYAEKLFDEVSALSIIQPVLKASKVIGYRVNGFFREYIISRPVEERVFFPVEVSALGRGHGRLTTEGIGQHLAVGDSWDVDRVVFEGLDFSRLRSLTVFRTVFWPWYVPDRMRVLRVLDLENAEYVSNYAFEKIMKLLPRLKFLSLRGQREVSRVPDSVGELMQLQTLDIRDTSIVALPPCITRLQKLQYIRAGTTIAFTQDDSLSAGEHSTPLSRRSNAMASRLLARFSRRGPDGSCRNGVEVPRGIERLKALRTLGAIDVNTAGDATLSEIRSLFRQLKKLELFMINRKISGWFLSHLFVAQHLESLSMQFEKSDHFVHWDYISLPRSLRSLKMHGHVEQLPRGIEYLGNLLKLTLEKTTLFTPDDIEVIGTLRSLRTLRLRVNKDQDGELQYHSSLFSKLEVLEIVCKSKLRVRFDIDAMEKLEQLKIHCLQGSEMQFSGLEHLFSLKQVWLMGSIDDALKVALEQQLVKHLKKPAPKLEVEPRSSQESSEESN*


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
1-665 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MSGAGKSGLVWNIYCKWRTSNNSWKHAWASVSHPFNPTDFSRNLLLHLLPKSTSSEERYYKAHPAKDPIQECQHLLHEHVYLVVIDGLQFKEDWDWIKSNLIGSGGLRSCIITITSEESVGKHCVVSSNNAVVHNIKGLEADAALELFKKKCMLYLSVFPQDRIIRRRRLVWRWIAEGYSKGTDSISMEKYAEKLFDEVSALSIIQPVLKASKVIGYRVNGFFREYIISRPVEERVFFPVEVSALGRGHGRLTTEGIGQHLAVGDSWDVDRVVFEGLDFSRLRSLTVFRTVFWPWYVPDRMRVLRVLDLENAEYVSNYAFEKIMKLLPRLKFLSLRGQREVSRVPDSVGELMQLQTLDIRDTSIVALPPCITRLQKLQYIRAGTTIAFTQDDSLSAGEHSTPLSRRSNAMASRLLARFSRRGPDGSCRNGVEVPRGIERLKALRTLGAIDVNTAGDATLSEIRSLFRQLKKLELFMINRKISGWFLSHLFVAQHLESLSMQFEKSDHFVHWDYISLPRSLRSLKMHGHVEQLPRGIEYLGNLLKLTLEKTTLFTPDDIEVIGTLRSLRTLRLRVNKDQDGELQYHSSLFSKLEVLEIVCKSKLRVRFDIDAMEKLEQLKIHCLQGSEMQFSGLEHLFSLKQVWLMGSIDDALKVALEQQLVKHLK

HMMPfam: PF00931
IPR002182
1-151 NB-ARC,NBS
NB-ARC

MSGAGKSGLVWNIYCKWRTSNNSWKHAWASVSHPFNPTDFSRNLLLHLLPKSTSSEERYYKAHPAKDPIQECQHLLHEHVYLVVIDGLQFKEDWDWIKSNLIGSGGLRSCIITITSEESVGKHCVVSSNNAVVHNIKGLEADAALELFKKK

HMMPanther: PTHR23155:SF212
1-665 OS11G0609700 PROTEIN,OS11G0609700 PROTEIN

MSGAGKSGLVWNIYCKWRTSNNSWKHAWASVSHPFNPTDFSRNLLLHLLPKSTSSEERYYKAHPAKDPIQECQHLLHEHVYLVVIDGLQFKEDWDWIKSNLIGSGGLRSCIITITSEESVGKHCVVSSNNAVVHNIKGLEADAALELFKKKCMLYLSVFPQDRIIRRRRLVWRWIAEGYSKGTDSISMEKYAEKLFDEVSALSIIQPVLKASKVIGYRVNGFFREYIISRPVEERVFFPVEVSALGRGHGRLTTEGIGQHLAVGDSWDVDRVVFEGLDFSRLRSLTVFRTVFWPWYVPDRMRVLRVLDLENAEYVSNYAFEKIMKLLPRLKFLSLRGQREVSRVPDSVGELMQLQTLDIRDTSIVALPPCITRLQKLQYIRAGTTIAFTQDDSLSAGEHSTPLSRRSNAMASRLLARFSRRGPDGSCRNGVEVPRGIERLKALRTLGAIDVNTAGDATLSEIRSLFRQLKKLELFMINRKISGWFLSHLFVAQHLESLSMQFEKSDHFVHWDYISLPRSLRSLKMHGHVEQLPRGIEYLGNLLKLTLEKTTLFTPDDIEVIGTLRSLRTLRLRVNKDQDGELQYHSSLFSKLEVLEIVCKSKLRVRFDIDAMEKLEQLKIHCLQGSEMQFSGLEHLFSLKQVWLMGSIDDALKVALEQQLVKHLK

Seg: seg
163-169 seg

RIIRRRR

Seg: seg
230-242 seg

RPVEERVFFPVEV

superfamily: SSF52047
279-599 RNI-like,LRR

FSRLRSLTVFRTVFWPWYVPDRMRVLRVLDLENAEYVSNYAFEKIMKLLPRLKFLSLRGQREVSRVPDSVGELMQLQTLDIRDTSIVALPPCITRLQKLQYIRAGTTIAFTQDDSLSAGEHSTPLSRRSNAMASRLLARFSRRGPDGSCRNGVEVPRGIERLKALRTLGAIDVNTAGDATLSEIRSLFRQLKKLELFMINRKISGWFLSHLFVAQHLESLSMQFEKSDHFVHWDYISLPRSLRSLKMHGHVEQLPRGIEYLGNLLKLTLEKTTLFTPDDIEVIGTLRSLRTLRLRVNKDQDGELQYHSSLFSKLEVLEIVC

Gene3D: G3DSA:3.80.10.10
427-576 no description

CRNGVEVPRGIERLKALRTLGAIDVNTAGDATLSEIRSLFRQLKKLELFMINRKISGWFLSHLFVAQHLESLSMQFEKSDHFVHWDYISLPRSLRSLKMHGHVEQLPRGIEYLGNLLKLTLEKTTLFTPDDIEVIGTLRSLRTLRLRVNK

Seg: seg
542-554 seg

LLKLTLEKTTLFT

Seg: seg
563-573 seg

TLRSLRTLRLR

Seg: seg
672-685 seg

EVEPRSSQESSEES






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox