PRGDB00181477 (Si027932m)

From PRG Wiki
Jump to: navigation, search
Si027932m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Setaria italica

Comment?

NB-ARC domain-containing disease resistance protein (best arabidopsis hit); Leucine Rich Repeat family protein (best rice hit)

DNA Sequence

ATGGCGGACCTTGCAATCGGGATTTCCAGGACGGCGGTTCAGTTGCTGGCGGACAAAGTCAGGACCGCCATCAAGGAGGAGGCAGAGCAGTGGCAGATTGTGCAGCGTGATCTCGTGTTCATCACGGGGGAGTTCGAGATGATGCAGTCCTTCCTCAACGTCGCCGACGCGGAGCGCGTCAGGAACGATGTTGTGTGGACCTGGGTGAGGCAGGTCCGCGACCTCTCCTATGACACGGAGGACTGCATTGAGTTCGTCCTCCAACTGGACACAAAGAAGAGGTCCTGGTGGCTCCGGCTGTTGCCGTCTTGTGGCAAGACGGAAGCAGCGCTGCCAGTGGACGAAGCCGTCGCCAAGACAACACTGCTGAGGGCTCGAGTGGTGGACGTGAGCCAGAGGAACATACGCTACAACCTTATTGTAGACTCTGGCTCCAGACCCATCAATCAGCAGGTTCAAAGGGCTGCTGCCTCCAGCAAAGGTTCATTTGACATTCTCACCAATGCTGTTAAGAAGACTGGCCCCTTGGATCTTCCCGGATTGATCACTAGGGAAGGCGAGGACCTTCAAGTGATCTCGGTCTGCGGACCAGAAGGTGATCTTGGGAAAGTAGCCATCATCAGGAAGTTGTACGGTGATTCAAGAATCTACAAGGAATTTGAATGCCGCGCCTGGGTGAAGCTTATGGAGCCTTTTAATGCTCATGAGTTTATACGGACCTTGATGATTCAGTTCTTCGCACACTCTTTCTGCAGCCAAGAACAACAAGAAGGAAGCATAAAGGAGTCTGCTCATAAAATCAACACACATAGGTACCTCATCGTCCTTGAAGACCTATATACCATGGCACAGTTGGATACCATCAGATCCTACCTGCCGGACATGAAGAAAGGAAGCCGGATTGTCGTGTTAACCCACCAGCCGGTGATCGCAAGCCTATGCGCGGGGGAGCCGTGTCGAGTTTTTGAGCTCGTCCAGTTTTCACCATATCACTCTGTCCGCGTCTATTTCAAAGAGCAAATCCAGGAAGGTCGTCTTATTTCTTTGTGGGGAATGCCTGGTGTTGGTAAATCAGGACTCGTTTGGGACATCTACTGCAAATGGCGGACTAGTAATAATTCATGGAAGCATGCTTGGGCCAGTGTTTCCAATCCATTCAATCCCACAGACTTCTCCCGAAATTTACTTCTGAATTTACTTCCGAAATCAACTTCTTCGGAGGAAAGATATTCTAAAGCACATCAGGCAAAAGATCCCATCCAAGAATGTCGACACCTTCTACATGAACATGTGTACCTAGTCATAATTGATGGTTTGCAGTTCGAGGAAGATTGGGATTGGATAAAATCTAACTTGATAGGAAGCGGAGGTTCAAGAAGCTGTATCATCACCATTACTTCGGAAGAAAGTGTTGGCAAACATTGTGCAGTATCATCAAACAATGCAGTAGTGCACAATATCAAAGGTCTTGAAGCTGATGCAGCCCTTGAACTGTTCAAAAAGTCACGACTGAGACCGAACCAAACAGACCTTTTTATCTTGTCCAAGTGTGGCGGGCTTCCCAAAGTGATAGTTACTTTGGCAAGATACTTGGCCAGCAGACCAAGCAAAGACGTACTCGAGCAGGAGATGAGGCGTCTGAGTGACAACTTTATGCACGAGCTAGAGACCAACCCAGAGTTTGATTCCTTACGTGGCATACTTGCCTGGATGCATTCTTACTTGCATGCTTGCCCTCGGCATCTCAAGAAATGCATGCTTTATCTATCGGTCTTTCCTCAAGACAGGATCATCCGGAGGAGGCGTTTGGTGAGGCGGTGGATCGCGGAGGGCTACTCAAAGGGCACCGACAGCATTAGCATGGAGAAGTACGCGGAGAAGCTTTTTGACGAGGTTGCTGCACTGAGCATCGATATCATGCAGCCAGTACTGAAGGCAACAAGTAAGGTTATTGGGTACCGAGTCAATGGTTTCTTCCGCGAGTATATCATCTCGCGGCCGGTGGAAGAGAGAGTTTTCTTTCCAGTGGAAGTCTCTGCACTGGAGAAGGGGCATGGCCAGCTGACCACAGAAGCCATAGGACAGCACCTAGCTGTTGGGGATTCCTGGGACAATGACCGGTTTGTGTTCGAGGGTTTGGACTTCTCACGGCTACGGTCTTTGACAATGTTTATACTTTTTAAGCCATGGTACGTCTCGGACAGGATGAGGGTGCTTCGGGTGCTGGATCTAGAGAATGCAGTGGATGTATGGAATTCTCATTTTGAGGCGATAGGGAAGCTGCTGCCTCGTCTGAAGTTCCTCTCGCTAAGAGGACAGAGGGAAGTCTCGCGAGTGCCAGATTCCGTGGGTGAGCTGATGCAGCTGCAAACTCTGGATATCAGAGACACCTCTATAGTCGCGCTACCACCATGCATCACCCGGCTACAGAAGCTGCAGTACATTCGTGCAGGTACCACCATAGCGTTCACGCAAGATGACAGCTTGTCCTCGGGGGAGCATTCGACTCCATTGAGTAGGAGGTCAAACGCTATGGCGTCCCGCTTGCTTGCCAGATTCAGCAGACGTGGACCTGATGGCTCTTGCAGGAATGGTGTTGAGGTGCCAAGAGGGATCGCGAGACTGAAAGCCTTGCAGACGCTTGGTGCTATACATGTAAATACTGCAGGGGATGCCACTTTTAATGAGATCGATTCCCTTCTCTCTCGCGACCAGTTGAAGAAACTCGAATTGTTCAGGATCAACCGCAAAACCAGCATTTGGAATCATTGGAGCAGTTTACATATGGCACAGCATTTGGAATCATTATCTTTGCAGTTTGAGAAGAGCGATCATTTTGTTCATTGGGACTACATCTCCCTTCCCAGAAGCCTACGGAGCCTAAAGATGCACGGCCATGTAGAGCAGGTCCCACCAAGTATCAGGGATCTTGGTATTCTCGTGAAGCTGACTTTAGAGAAGACTACACTGTTCACAACAGGTGAGATAAAGGTCATCGGGAGCTTACCAAGTCTGCGTACTCTGCGCCTCCGTGTCAATAAAGATCAAGATGGCGAGCTCCAATTTCACTCTGGCCTTTTCAGCAAACTCGAGGTCCTCGAGATTGCCTGCAAATGGAAATTACGTGTAAGGTTTGACATTGATGCAATGGAAAAGCTTGAGCAGCTGAAGATTCACTGCCTTCAGGGGTCGGAGATGCAGTTCTCTGGGTTAGAGCACCCGGTTTCCCTCAAGCAAGTCTGGCTTATGGGTTCCTTCGACGACGCACTCAAGGTAGCATTGGGGCAGCAACTTGTCAAGCATCTGAAGAAACCTGCTCTGAAACTGGAGGTTGAGCCACGTTCGTCCCAGGAGTCGTCCGAGGAGTCGAACTAA


Protein sequences

Name Description Sequence
Si027932m NB-ARC domain-containing disease resistance protein (best arabidopsis hit); Leucine Rich Repeat family protein (best rice hit)

MADLAIGISRTAVQLLADKVRTAIKEEAEQWQIVQRDLVFITGEFEMMQSFLNVADAERVRNDVVWTWVRQVRDLSYDTEDCIEFVLQLDTKKRSWWLRLLPSCGKTEAALPVDEAVAKTTLLRARVVDVSQRNIRYNLIVDSGSRPINQQVQRAAASSKGSFDILTNAVKKTGPLDLPGLITREGEDLQVISVCGPEGDLGKVAIIRKLYGDSRIYKEFECRAWVKLMEPFNAHEFIRTLMIQFFAHSFCSQEQQEGSIKESAHKINTHRYLIVLEDLYTMAQLDTIRSYLPDMKKGSRIVVLTHQPVIASLCAGEPCRVFELVQFSPYHSVRVYFKEQIQEGRLISLWGMPGVGKSGLVWDIYCKWRTSNNSWKHAWASVSNPFNPTDFSRNLLLNLLPKSTSSEERYSKAHQAKDPIQECRHLLHEHVYLVIIDGLQFEEDWDWIKSNLIGSGGSRSCIITITSEESVGKHCAVSSNNAVVHNIKGLEADAALELFKKSRLRPNQTDLFILSKCGGLPKVIVTLARYLASRPSKDVLEQEMRRLSDNFMHELETNPEFDSLRGILAWMHSYLHACPRHLKKCMLYLSVFPQDRIIRRRRLVRRWIAEGYSKGTDSISMEKYAEKLFDEVAALSIDIMQPVLKATSKVIGYRVNGFFREYIISRPVEERVFFPVEVSALEKGHGQLTTEAIGQHLAVGDSWDNDRFVFEGLDFSRLRSLTMFILFKPWYVSDRMRVLRVLDLENAVDVWNSHFEAIGKLLPRLKFLSLRGQREVSRVPDSVGELMQLQTLDIRDTSIVALPPCITRLQKLQYIRAGTTIAFTQDDSLSSGEHSTPLSRRSNAMASRLLARFSRRGPDGSCRNGVEVPRGIARLKALQTLGAIHVNTAGDATFNEIDSLLSRDQLKKLELFRINRKTSIWNHWSSLHMAQHLESLSLQFEKSDHFVHWDYISLPRSLRSLKMHGHVEQVPPSIRDLGILVKLTLEKTTLFTTGEIKVIGSLPSLRTLRLRVNKDQDGELQFHSGLFSKLEVLEIACKWKLRVRFDIDAMEKLEQLKIHCLQGSEMQFSGLEHPVSLKQVWLMGSFDDALKVALGQQLVKHLKKPALKLEVEPRSSQESSEESN*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF212
6-1067 OS11G0609700 PROTEIN,OS11G0609700 PROTEIN

IGISRTAVQLLADKVRTAIKEEAEQWQIVQRDLVFITGEFEMMQSFLNVADAERVRNDVVWTWVRQVRDLSYDTEDCIEFVLQLDTKKRSWWLRLLPSCGKTEAALPVDEAVAKTTLLRARVVDVSQRNIRYNLIVDSGSRPINQQVQRAAASSKGSFDILTNAVKKTGPLDLPGLITREGEDLQVISVCGPEGDLGKVAIIRKLYGDSRIYKEFECRAWVKLMEPFNAHEFIRTLMIQFFAHSFCSQEQQEGSIKESAHKINTHRYLIVLEDLYTMAQLDTIRSYLPDMKKGSRIVVLTHQPVIASLCAGEPCRVFELVQFSPYHSVRVYFKEQIQEGRLISLWGMPGVGKSGLVWDIYCKWRTSNNSWKHAWASVSNPFNPTDFSRNLLLNLLPKSTSSEERYSKAHQAKDPIQECRHLLHEHVYLVIIDGLQFEEDWDWIKSNLIGSGGSRSCIITITSEESVGKHCAVSSNNAVVHNIKGLEADAALELFKKSRLRPNQTDLFILSKCGGLPKVIVTLARYLASRPSKDVLEQEMRRLSDNFMHELETNPEFDSLRGILAWMHSYLHACPRHLKKCMLYLSVFPQDRIIRRRRLVRRWIAEGYSKGTDSISMEKYAEKLFDEVAALSIDIMQPVLKATSKVIGYRVNGFFREYIISRPVEERVFFPVEVSALEKGHGQLTTEAIGQHLAVGDSWDNDRFVFEGLDFSRLRSLTMFILFKPWYVSDRMRVLRVLDLENAVDVWNSHFEAIGKLLPRLKFLSLRGQREVSRVPDSVGELMQLQTLDIRDTSIVALPPCITRLQKLQYIRAGTTIAFTQDDSLSSGEHSTPLSRRSNAMASRLLARFSRRGPDGSCRNGVEVPRGIARLKALQTLGAIHVNTAGDATFNEIDSLLSRDQLKKLELFRINRKTSIWNHWSSLHMAQHLESLSLQFEKSDHFVHWDYISLPRSLRSLKMHGHVEQVPPSIRDLGILVKLTLEKTTLFTTGEIKVIGSLPSLRTLRLRVNKDQDGELQFHSGLFSKLEVLEIACKWKLRVRFDIDAMEKLEQLKIHCLQGSEMQ

HMMPanther: PTHR23155
6-1067 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IGISRTAVQLLADKVRTAIKEEAEQWQIVQRDLVFITGEFEMMQSFLNVADAERVRNDVVWTWVRQVRDLSYDTEDCIEFVLQLDTKKRSWWLRLLPSCGKTEAALPVDEAVAKTTLLRARVVDVSQRNIRYNLIVDSGSRPINQQVQRAAASSKGSFDILTNAVKKTGPLDLPGLITREGEDLQVISVCGPEGDLGKVAIIRKLYGDSRIYKEFECRAWVKLMEPFNAHEFIRTLMIQFFAHSFCSQEQQEGSIKESAHKINTHRYLIVLEDLYTMAQLDTIRSYLPDMKKGSRIVVLTHQPVIASLCAGEPCRVFELVQFSPYHSVRVYFKEQIQEGRLISLWGMPGVGKSGLVWDIYCKWRTSNNSWKHAWASVSNPFNPTDFSRNLLLNLLPKSTSSEERYSKAHQAKDPIQECRHLLHEHVYLVIIDGLQFEEDWDWIKSNLIGSGGSRSCIITITSEESVGKHCAVSSNNAVVHNIKGLEADAALELFKKSRLRPNQTDLFILSKCGGLPKVIVTLARYLASRPSKDVLEQEMRRLSDNFMHELETNPEFDSLRGILAWMHSYLHACPRHLKKCMLYLSVFPQDRIIRRRRLVRRWIAEGYSKGTDSISMEKYAEKLFDEVAALSIDIMQPVLKATSKVIGYRVNGFFREYIISRPVEERVFFPVEVSALEKGHGQLTTEAIGQHLAVGDSWDNDRFVFEGLDFSRLRSLTMFILFKPWYVSDRMRVLRVLDLENAVDVWNSHFEAIGKLLPRLKFLSLRGQREVSRVPDSVGELMQLQTLDIRDTSIVALPPCITRLQKLQYIRAGTTIAFTQDDSLSSGEHSTPLSRRSNAMASRLLARFSRRGPDGSCRNGVEVPRGIARLKALQTLGAIHVNTAGDATFNEIDSLLSRDQLKKLELFRINRKTSIWNHWSSLHMAQHLESLSLQFEKSDHFVHWDYISLPRSLRSLKMHGHVEQVPPSIRDLGILVKLTLEKTTLFTTGEIKVIGSLPSLRTLRLRVNKDQDGELQFHSGLFSKLEVLEIACKWKLRVRFDIDAMEKLEQLKIHCLQGSEMQ

HMMPfam: PF00931
IPR002182
185-332 NB-ARC,NBS
NB-ARC

EGEDLQVISVCGPEGDLGKVAIIRKLYGDSRIYKEFECRAWVKLMEPFNAHEFIRTLMIQFFAHSFCSQEQQEGSIKESAHKINTHRYLIVLEDLYTMAQLDTIRSYLPDMKKGSRIVVLTHQPVIASLCAGEPCRVFELVQFSPYHS

superfamily: SSF52540
187-330 P-loop containing nucleoside triphosphate hydrolases

EDLQVISVCGPEGDLGKVAIIRKLYGDSRIYKEFECRAWVKLMEPFNAHEFIRTLMIQFFAHSFCSQEQQEGSIKESAHKINTHRYLIVLEDLYTMAQLDTIRSYLPDMKKGSRIVVLTHQPVIASLCAGEPCRVFELVQFSPY

HMMPfam: PF00931
IPR002182
342-612 NB-ARC,NBS
NB-ARC

QEGRLISLWGMPGVGKSGLVWDIYCKWRTSNNSWKHAWASVSNPFNPTDFSRNLLLNLLPKSTSSEERYSKAHQAKDPIQECRHLLHEHVYLVIIDGLQFEEDWDWIKSNLIGSGGSRSCIITITSEESVGKHCAVSSNNAVVHNIKGLEADAALELFKKSRLRPNQTDLFILSKCGGLPKVIVTLARYLASRPSKDVLEQEMRRLSDNFMHELETNPEFDSLRGILAWMHSYLHACPRHLKKCMLYLSVFPQDRIIRRRRLVRRWIAEGY

superfamily: SSF52540
342-555 P-loop containing nucleoside triphosphate hydrolases

QEGRLISLWGMPGVGKSGLVWDIYCKWRTSNNSWKHAWASVSNPFNPTDFSRNLLLNLLPKSTSSEERYSKAHQAKDPIQECRHLLHEHVYLVIIDGLQFEEDWDWIKSNLIGSGGSRSCIITITSEESVGKHCAVSSNNAVVHNIKGLEADAALELFKKSRLRPNQTDLFILSKCGGLPKVIVTLARYLASRPSKDVLEQEMRRLSDNFMHEL

FPrintScan: PR00364
IPR000767
346-361 DISEASERSIST
Disease resistance protein

LISLWGMPGVGKSGLV

FPrintScan: PR00364
IPR000767
426-440 DISEASERSIST
Disease resistance protein

LLHEHVYLVIIDGLQ

FPrintScan: PR00364
IPR000767
517-531 DISEASERSIST
Disease resistance protein

CGGLPKVIVTLARYL

Seg: seg
596-608 seg

RIIRRRRLVRRWI

Seg: seg
666-678 seg

RPVEERVFFPVEV

Gene3D: G3DSA:3.80.10.10
707-820 no description

RFVFEGLDFSRLRSLTMFILFKPWYVSDRMRVLRVLDLENAVDVWNSHFEAIGKLLPRLKFLSLRGQREVSRVPDSVGELMQLQTLDIRDTSIVALPPCITRLQKLQYIRAGTT

superfamily: SSF52047
718-1062 RNI-like,LRR

LRSLTMFILFKPWYVSDRMRVLRVLDLENAVDVWNSHFEAIGKLLPRLKFLSLRGQREVSRVPDSVGELMQLQTLDIRDTSIVALPPCITRLQKLQYIRAGTTIAFTQDDSLSSGEHSTPLSRRSNAMASRLLARFSRRGPDGSCRNGVEVPRGIARLKALQTLGAIHVNTAGDATFNEIDSLLSRDQLKKLELFRINRKTSIWNHWSSLHMAQHLESLSLQFEKSDHFVHWDYISLPRSLRSLKMHGHVEQVPPSIRDLGILVKLTLEKTTLFTTGEIKVIGSLPSLRTLRLRVNKDQDGELQFHSGLFSKLEVLEIACKWKLRVRFDIDAMEKLEQLKIHCLQ

FPrintScan: PR00364
IPR000767
784-800 DISEASERSIST
Disease resistance protein

GELMQLQTLDIRDTSIV

Gene3D: G3DSA:3.80.10.10
868-1058 no description

VPRGIARLKALQTLGAIHVNTAGDATFNEIDSLLSRDQLKKLELFRINRKTSIWNHWSSLHMAQHLESLSLQFEKSDHFVHWDYISLPRSLRSLKMHGHVEQVPPSIRDLGILVKLTLEKTTLFTTGEIKVIGSLPSLRTLRLRVNKDQDGELQFHSGLFSKLEVLEIACKWKLRVRFDIDAMEKLEQLKI

Seg: seg
980-993 seg

LVKLTLEKTTLFTT

Seg: seg
1110-1123 seg

EVEPRSSQESSEES






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox