PRGDB00181480 (Si026026m)

From PRG Wiki
Jump to: navigation, search
Si026026m
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Setaria italica

Comment?

disease resistance protein (TIR-NBS-LRR class) (best arabidopsis hit); NBS-LRR disease resistance protein, putative (best rice hit)

DNA Sequence

ATGAAATTTTTGCAGAAGCCAGGAGTGCTTTCATGTCTACCAGTTGCACACAAGAAGATTGTCGTGGCTAATAGGATGAAGAGTATGAGAGAAGAACTGAGGAAAATCAGCAAGGACTTTCGGGATTTTAAATTCTCAGAGGGTCGCACTTGCACATCTCTTGAGCAACATGATGACGATCGTGAAACATCATCACGTTTGCCTGAAGAACCAATAATTGGGAGGAATAGAGAAAAGCAGGAAATCATAAACCTCTTATCCGCAGGTACCAACAATGATGAGACTGTGATTGTTTCTATCCATGGCCTTGGAGGTATGGGCAAGAGTACTTTGGCACAACTAATATACAATGATGCGCAATTCAAGAAGTATGACCATCGTATATGGGTTTATGTGTCCCGGGATTTCAGTCTAAAGAAAATAGGAAGCTCTATAATTTCTCTAATACCAATAGAAGGAGGCCAGCAGAATAGGGATACACTGGAAGCCATAAATCAGTGCCTAGACAACCTACTCCGTGGCAAGAAAGTTCTTATTGTTTTAGATGACTTATGGGAGGAAAAGGACAATGAGTTGGGGAAATTGAGGAGTATGCTTCAGGTGGGCAAGAAGGGCACTACCATAGATGTCATAGTAACCACGCGCAAGGAAGACATTGCAAGGAAAGTTTCCACATGTACACCATACAAGCTGCAGCCTTTGAACGATAATACATGCTGGGAAATAATTAAGAGATATAGCAGGTTTGAAGATCAACATTACCAAGAAAGATTAGAGAAGATAGGATTGGACATTGCAAAGAAATGTGGAGAGTCGGGCTGGTGGTCGCCACAAAGGTGCTTGCCCTTTGTCGTTGCAAGCATGTGCATAGGACGAGCACCTCTTCCTTGCTCCGCTACCCATCATGGAGAGACTTCGGGAGATCATATGGAGCGGTACACTATGCATGACCTGGTGCATGATCTGGCAACATTAATCATGGGTGATGAGTTAATTGTTTCTAATGTTGCATCGAAGAATAATAAAACAAATAGCCAGAAATATTGTCGCTATGCATCAGTTACCAAATATGACAACACAACAAAGTTATCCAATGTTTTACCCTCAAAGGTGAGGGCACTTCATTTCTCAGATAGCAGCAAGTTGGATCTCTCTTGTGGGGCATTTTCATTTGCAAAGTGTTTGCGTATTTTGGATTTTAGTGGATGCTCTGGTATACTGTTGCCAGCCTCTATTGGGAAACTGAAGCAGCTGAAGTACCTTACTGCTTCACAAATGCAAAATGATGTTCTCCCAGAGTTTATGACTGAGCTATCAAAACTGCAGTACCTGAACCTGAATGGATCTTCTCACATTTCTGCACTACCAGAATCAATGGGCAAGCTCTGGTGTCTGAAATATCTGGGTTTGTCAGGTTGTTCTGGCATATCAAAACTGCCAGGATCATTTGGTGATTTAAAATGTATGATGCATCTTGACATGTCAGGTTGTTCTGGGATAAGAGAACTGCCAGATTCACTTGGTAATCTCACAAATTTGCATCATCTTGATTTATCTGAATGTTCCGGTGTCAAGGAAATACCTGAATCTTTGTGTGGCCTCACACATCTCCAGTATTTGAACTTATCATTTTGTCGTTATATCGGACGGCTAGCAGAAGCTATAGGCAGCCTGCATCTGGACCTATCGATGAACCGATTTGAGTATCTACCAGAAAGTATTGGTAATCTCAAAAGGCTGCATACACTGAATCTCATGAATTGCTGGTTTCTCAAGTCCCTCCCAGAGAGTATAGGTTGTGCAACTGGGCTAAAGCTATTTCACCACTTTCGGGCCCTCCAGAAGTTGCACTTCTTCGGGTGTCAAAACCTGGAGAGTTTGCCGGAGGGCATACAACAACTCTCCTCCCTTCAGACGCTCAGGTTGGCTAAATGTCACAGCATATCAACACTGCCGGAATGGCTGAGCGACATCTCCTCTCTTAAAAGTCTCGTGATCGAGGGCTTTGATAGCATCAAGTCTTTGCCTGCATGTATACAGCACCTCACCAACCTCGAGGAGTTAGTTATTGAGGGGAACCAGGAACTACAGCAGTGGTGCAAGTCAGAAGAGAACAAGGCCAAGCTCGCACACATTAACATAGTAAGTTCACGACCATCGCATTTATTTTTCTAA


Protein sequences

Name Description Sequence
Si026026m disease resistance protein (TIR-NBS-LRR class) (best arabidopsis hit); NBS-LRR disease resistance protein, putative (best rice hit)

MKFLQKPGVLSCLPVAHKKIVVANRMKSMREELRKISKDFRDFKFSEGRTCTSLEQHDDDRETSSRLPEEPIIGRNREKQEIINLLSAGTNNDETVIVSIHGLGGMGKSTLAQLIYNDAQFKKYDHRIWVYVSRDFSLKKIGSSIISLIPIEGGQQNRDTLEAINQCLDNLLRGKKVLIVLDDLWEEKDNELGKLRSMLQVGKKGTTIDVIVTTRKEDIARKVSTCTPYKLQPLNDNTCWEIIKRYSRFEDQHYQERLEKIGLDIAKKCGESGWWSPQRCLPFVVASMCIGRAPLPCSATHHGETSGDHMERYTMHDLVHDLATLIMGDELIVSNVASKNNKTNSQKYCRYASVTKYDNTTKLSNVLPSKVRALHFSDSSKLDLSCGAFSFAKCLRILDFSGCSGILLPASIGKLKQLKYLTASQMQNDVLPEFMTELSKLQYLNLNGSSHISALPESMGKLWCLKYLGLSGCSGISKLPGSFGDLKCMMHLDMSGCSGIRELPDSLGNLTNLHHLDLSECSGVKEIPESLCGLTHLQYLNLSFCRYIGRLAEAIGSLHLDLSMNRFEYLPESIGNLKRLHTLNLMNCWFLKSLPESIGCATGLKLFHHFRALQKLHFFGCQNLESLPEGIQQLSSLQTLRLAKCHSISTLPEWLSDISSLKSLVIEGFDSIKSLPACIQHLTNLEELVIEGNQELQQWCKSEENKAKLAHINIVSSRPSHLFF*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
23-719 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ANRMKSMREELRKISKDFRDFKFSEGRTCTSLEQHDDDRETSSRLPEEPIIGRNREKQEIINLLSAGTNNDETVIVSIHGLGGMGKSTLAQLIYNDAQFKKYDHRIWVYVSRDFSLKKIGSSIISLIPIEGGQQNRDTLEAINQCLDNLLRGKKVLIVLDDLWEEKDNELGKLRSMLQVGKKGTTIDVIVTTRKEDIARKVSTCTPYKLQPLNDNTCWEIIKRYSRFEDQHYQERLEKIGLDIAKKCGESGWWSPQRCLPFVVASMCIGRAPLPCSATHHGETSGDHMERYTMHDLVHDLATLIMGDELIVSNVASKNNKTNSQKYCRYASVTKYDNTTKLSNVLPSKVRALHFSDSSKLDLSCGAFSFAKCLRILDFSGCSGILLPASIGKLKQLKYLTASQMQNDVLPEFMTELSKLQYLNLNGSSHISALPESMGKLWCLKYLGLSGCSGISKLPGSFGDLKCMMHLDMSGCSGIRELPDSLGNLTNLHHLDLSECSGVKEIPESLCGLTHLQYLNLSFCRYIGRLAEAIGSLHLDLSMNRFEYLPESIGNLKRLHTLNLMNCWFLKSLPESIGCATGLKLFHHFRALQKLHFFGCQNLESLPEGIQQLSSLQTLRLAKCHSISTLPEWLSDISSLKSLVIEGFDSIKSLPACIQHLTNLEELVIEGNQELQQWCKSEENKAKLAHINIVSSRP

HMMPanther: PTHR23155:SF252
23-719 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ANRMKSMREELRKISKDFRDFKFSEGRTCTSLEQHDDDRETSSRLPEEPIIGRNREKQEIINLLSAGTNNDETVIVSIHGLGGMGKSTLAQLIYNDAQFKKYDHRIWVYVSRDFSLKKIGSSIISLIPIEGGQQNRDTLEAINQCLDNLLRGKKVLIVLDDLWEEKDNELGKLRSMLQVGKKGTTIDVIVTTRKEDIARKVSTCTPYKLQPLNDNTCWEIIKRYSRFEDQHYQERLEKIGLDIAKKCGESGWWSPQRCLPFVVASMCIGRAPLPCSATHHGETSGDHMERYTMHDLVHDLATLIMGDELIVSNVASKNNKTNSQKYCRYASVTKYDNTTKLSNVLPSKVRALHFSDSSKLDLSCGAFSFAKCLRILDFSGCSGILLPASIGKLKQLKYLTASQMQNDVLPEFMTELSKLQYLNLNGSSHISALPESMGKLWCLKYLGLSGCSGISKLPGSFGDLKCMMHLDMSGCSGIRELPDSLGNLTNLHHLDLSECSGVKEIPESLCGLTHLQYLNLSFCRYIGRLAEAIGSLHLDLSMNRFEYLPESIGNLKRLHTLNLMNCWFLKSLPESIGCATGLKLFHHFRALQKLHFFGCQNLESLPEGIQQLSSLQTLRLAKCHSISTLPEWLSDISSLKSLVIEGFDSIKSLPACIQHLTNLEELVIEGNQELQQWCKSEENKAKLAHINIVSSRP

superfamily: SSF52540
55-270 P-loop containing nucleoside triphosphate hydrolases

EQHDDDRETSSRLPEEPIIGRNREKQEIINLLSAGTNNDETVIVSIHGLGGMGKSTLAQLIYNDAQFKKYDHRIWVYVSRDFSLKKIGSSIISLIPIEGGQQNRDTLEAINQCLDNLLRGKKVLIVLDDLWEEKDNELGKLRSMLQVGKKGTTIDVIVTTRKEDIARKVSTCTPYKLQPLNDNTCWEIIKRYSRFEDQHYQERLEKIGLDIAKKCG

Gene3D: G3DSA:3.40.50.300
73-223 no description

IGRNREKQEIINLLSAGTNNDETVIVSIHGLGGMGKSTLAQLIYNDAQFKKYDHRIWVYVSRDFSLKKIGSSIISLIPIEGGQQNRDTLEAINQCLDNLLRGKKVLIVLDDLWEEKDNELGKLRSMLQVGKKGTTIDVIVTTRKEDIARKV

HMMPfam: PF00931
IPR002182
77-270 NB-ARC,NBS
NB-ARC

REKQEIINLLSAGTNNDETVIVSIHGLGGMGKSTLAQLIYNDAQFKKYDHRIWVYVSRDFSLKKIGSSIISLIPIEGGQQNRDTLEAINQCLDNLLRGKKVLIVLDDLWEEKDNELGKLRSMLQVGKKGTTIDVIVTTRKEDIARKVSTCTPYKLQPLNDNTCWEIIKRYSRFEDQHYQERLEKIGLDIAKKCG

FPrintScan: PR00364
IPR000767
97-112 DISEASERSIST
Disease resistance protein

IVSIHGLGGMGKSTLA

Seg: seg
137-149 seg

SLKKIGSSIISLI

FPrintScan: PR00364
IPR000767
171-185 DISEASERSIST
Disease resistance protein

LLRGKKVLIVLDDLW

superfamily: SSF52058
314-724 L domain-like,LRR

TMHDLVHDLATLIMGDELIVSNVASKNNKTNSQKYCRYASVTKYDNTTKLSNVLPSKVRALHFSDSSKLDLSCGAFSFAKCLRILDFSGCSGILLPASIGKLKQLKYLTASQMQNDVLPEFMTELSKLQYLNLNGSSHISALPESMGKLWCLKYLGLSGCSGISKLPGSFGDLKCMMHLDMSGCSGIRELPDSLGNLTNLHHLDLSECSGVKEIPESLCGLTHLQYLNLSFCRYIGRLAEAIGSLHLDLSMNRFEYLPESIGNLKRLHTLNLMNCWFLKSLPESIGCATGLKLFHHFRALQKLHFFGCQNLESLPEGIQQLSSLQTLRLAKCHSISTLPEWLSDISSLKSLVIEGFDSIKSLPACIQHLTNLEELVIEGNQELQQWCKSEENKAKLAHINIVSSRPSHLFF

Gene3D: G3DSA:3.80.10.10
363-607 no description

LSNVLPSKVRALHFSDSSKLDLSCGAFSFAKCLRILDFSGCSGILLPASIGKLKQLKYLTASQMQNDVLPEFMTELSKLQYLNLNGSSHISALPESMGKLWCLKYLGLSGCSGISKLPGSFGDLKCMMHLDMSGCSGIRELPDSLGNLTNLHHLDLSECSGVKEIPESLCGLTHLQYLNLSFCRYIGRLAEAIGSLHLDLSMNRFEYLPESIGNLKRLHTLNLMNCWFLKSLPESIGCATGLKLF

HMMPfam: PF13855
491-546 LRR_8,Leucine rich repeat

HLDMSGCSGIRELPDSLGNLTNLHHLDLSECSGVKEIPESLCGLTHLQYLNLSFCR

FPrintScan: PR00364
IPR000767
508-524 DISEASERSIST
Disease resistance protein

GNLTNLHHLDLSECSGV

HMMPfam: PF00560
IPR001611
559-577 LRR_1
Leucine-rich repeat

HLDLSMNRFEYLPESIGNL

Gene3D: G3DSA:3.80.10.10
622-694 no description

QNLESLPEGIQQLSSLQTLRLAKCHSISTLPEWLSDISSLKSLVIEGFDSIKSLPACIQHLTNLEELVIEGNQ

HMMPfam: PF13855
635-694 LRR_8,Leucine rich repeat

SSLQTLRLAKCHSISTLPEWLSDISSLKSLVIEGFDSIKSLPACIQHLTNLEELVIEGNQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox