PRGDB00181689 (10889)

From PRG Wiki
Jump to: navigation, search
10889
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

leucine-rich repeat transmembrane protein kinase family protein (best arabidopsis hit)

DNA Sequence

GACAGGCAGGCACTCATCGATTTCATGAAGTTTGCAGATCCACAAAACAGAATCTTGCAATGGAACGTCTCCAGCCTCAATCCATGCACGGATCAAAACGCCTGGCAAGGGGTCAATTGCAAGAAGCCAGTGATCGGCCGTGTCACGTTTCTGGAGCTCGAGAACTTGGATCTTCCGGGAACCATAGCACCAAACACGTTGAGCAGGCTAGATCAACTCCGAGTTCTAAGGCTCATCAACGTCTCGCTCTCCGGGCCCATTCCCCCTGATCTCTCCAGCTGCATCCACCTCAAGCAACTCATCTTGCTCGGCAACAAGCTCACCGGTAATATCCCTGCCTCGCTAGGCACGCTGGCCATCTTAGATCGCTTGTCACTCCGAAACAATCAGCTGGAGGGAGAGATCCCACGGGAACTCAGCAGTCTCCAGGAATTGCAGACGCTCAGGCTCGACTACAACTCTCTCACAGGTCCGATCCCAGATATGTTGTTCCCCAAGATGACAGACTTCGGTGTCTCCCACAACCGATTGACTGGCAGCATTCCAAAATCACTCGCATCCACAAGCCCAACTTCATTCGCAGGGAACGATCTTTGTGGGCCGCCAACTAACAACAGTTGCCCACCACTACCATCGCCCTCGTCTCCAGAGAATGCCCACTCGGAACCTCGCTCTTCTGAAAGCGACAAGCTCAGCCTCCCAAGCATCATAATCATCGTCGTCTTCAGCCTCGCCATCGTCGTGTTTATCTGTCTCCTCCTCATGTTCTACCTCAGGAGAGGAAATCCCGACGACAAAAACAAGCTTGTGACACACAAATCGAAGAGTCCCGAGAAAAAAGATGGCGGAGAGGTGCAAAGCATAGACTCGGCGAGCATGCAGTTCCCGGAGCAGCGAGGATCAGTGGAGGGTGAAGCCGGGAGGCTAATTTTCGCTGCCGAGGACAATCAACACAGCTTTGGCTTGAAAGAATTGCTTCGGGCATCTGCGGAGATGCTTGTTCCCAAAGGCACTGTGGGAACAACGTACAAGGCTGTCCTGGGCGAAGGTGTCGTATTCGCTGTAAAGCGGCTGATTGACAGAAACTTGACGGAGAAAGCCGAGTTTGAGAAGCAGCTTGCGCTTGTAGGCAGGCTCAAGCACCCAAACTTGGTTCCGCTGGTGGCCTACTATTACTACGCGCAAGAGGAGAAGCTCCTGGTCTACGACTATCTCCCAAACAAAAGCCTCTACACTCGTTTGCACGCCAACCGAGGAACGAACGAGCGGGAACTATTGGCATGGCCGGATCGCCTACAGATAGCCTACGGCGTAGCGCAGGGGCTGGCATTTCTTCACCGGGAGTGCCCAACAATGCCACACGGCAACTTGAAATCCACCAACGTAGTATTCGATGGAAACGGGCAGGCTTGCATTGCGGACTTTGGGCTGCTGCCGTTTGCGAGCGTCCAGAACGGTCCGCAGGCGAGCGATGGCTACAGGGCACCGGAGATGTTTGTGGCCAAGAAGGTGACGCACAAGGCAGATGTCTACAGCTTCGGGGTGATGCTGCTGGAGCTCTTGACGGGCAGGGTGGCGGCGAGGCAGGGCAGCAGCGTTGACCTGCCCAGGTGGGTCAACTCCACGGTCCGCGAGGAGTGGACCGCCGAGGTATTTGACTACGAGCTCGTCACCTACAGGAGAAACTCCGAGGAGGAGATGGTGTATCTGCTGAGGATTGCACTCGACTGCGTTGCGTCCAATCCGGAGCAGCGACCCAAGATGGCCCAGGTTGTGAAGCTGATTGAAGACATCAAG


Protein sequences

Name Description Sequence
10889 leucine-rich repeat transmembrane protein kinase family protein (best arabidopsis hit)

DRQALIDFMKFADPQNRILQWNVSSLNPCTDQNAWQGVNCKKPVIGRVTFLELENLDLPGTIAPNTLSRLDQLRVLRLINVSLSGPIPPDLSSCIHLKQLILLGNKLTGNIPASLGTLAILDRLSLRNNQLEGEIPRELSSLQELQTLRLDYNSLTGPIPDMLFPKMTDFGVSHNRLTGSIPKSLASTSPTSFAGNDLCGPPTNNSCPPLPSPSSPENAHSEPRSSESDKLSLPSIIIIVVFSLAIVVFICLLLMFYLRRGNPDDKNKLVTHKSKSPEKKDGGEVQSIDSASMQFPEQRGSVEGEAGRLIFAAEDNQHSFGLKELLRASAEMLVPKGTVGTTYKAVLGEGVVFAVKRLIDRNLTEKAEFEKQLALVGRLKHPNLVPLVAYYYYAQEEKLLVYDYLPNKSLYTRLHANRGTNERELLAWPDRLQIAYGVAQGLAFLHRECPTMPHGNLKSTNVVFDGNGQACIADFGLLPFASVQNGPQASDGYRAPEMFVAKKVTHKADVYSFGVMLLELLTGRVAARQGSSVDLPRWVNSTVREEWTAEVFDYELVTYRRNSEEEMVYLLRIALDCVASNPEQRPKMAQVVKLIEDIK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF779
1-599 PTHR24420:SF779

DRQALIDFMKFADPQNRILQWNVSSLNPCTDQNAWQGVNCKKPVIGRVTFLELENLDLPGTIAPNTLSRLDQLRVLRLINVSLSGPIPPDLSSCIHLKQLILLGNKLTGNIPASLGTLAILDRLSLRNNQLEGEIPRELSSLQELQTLRLDYNSLTGPIPDMLFPKMTDFGVSHNRLTGSIPKSLASTSPTSFAGNDLCGPPTNNSCPPLPSPSSPENAHSEPRSSESDKLSLPSIIIIVVFSLAIVVFICLLLMFYLRRGNPDDKNKLVTHKSKSPEKKDGGEVQSIDSASMQFPEQRGSVEGEAGRLIFAAEDNQHSFGLKELLRASAEMLVPKGTVGTTYKAVLGEGVVFAVKRLIDRNLTEKAEFEKQLALVGRLKHPNLVPLVAYYYYAQEEKLLVYDYLPNKSLYTRLHANRGTNERELLAWPDRLQIAYGVAQGLAFLHRECPTMPHGNLKSTNVVFDGNGQACIADFGLLPFASVQNGPQASDGYRAPEMFVAKKVTHKADVYSFGVMLLELLTGRVAARQGSSVDLPRWVNSTVREEWTAEVFDYELVTYRRNSEEEMVYLLRIALDCVASNPEQRPKMAQVVKLIEDIK

HMMPfam: PF08263
IPR013210
1-40 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DRQALIDFMKFADPQNRILQWNVSSLNPCTDQNAWQGVNC

HMMPanther: PTHR24420
1-599 PTHR24420,FAMILY NOT NAMED

DRQALIDFMKFADPQNRILQWNVSSLNPCTDQNAWQGVNCKKPVIGRVTFLELENLDLPGTIAPNTLSRLDQLRVLRLINVSLSGPIPPDLSSCIHLKQLILLGNKLTGNIPASLGTLAILDRLSLRNNQLEGEIPRELSSLQELQTLRLDYNSLTGPIPDMLFPKMTDFGVSHNRLTGSIPKSLASTSPTSFAGNDLCGPPTNNSCPPLPSPSSPENAHSEPRSSESDKLSLPSIIIIVVFSLAIVVFICLLLMFYLRRGNPDDKNKLVTHKSKSPEKKDGGEVQSIDSASMQFPEQRGSVEGEAGRLIFAAEDNQHSFGLKELLRASAEMLVPKGTVGTTYKAVLGEGVVFAVKRLIDRNLTEKAEFEKQLALVGRLKHPNLVPLVAYYYYAQEEKLLVYDYLPNKSLYTRLHANRGTNERELLAWPDRLQIAYGVAQGLAFLHRECPTMPHGNLKSTNVVFDGNGQACIADFGLLPFASVQNGPQASDGYRAPEMFVAKKVTHKADVYSFGVMLLELLTGRVAARQGSSVDLPRWVNSTVREEWTAEVFDYELVTYRRNSEEEMVYLLRIALDCVASNPEQRPKMAQVVKLIEDIK

Gene3D: G3DSA:3.80.10.10
11-188 G3DSA:3.80.10.10

FADPQNRILQWNVSSLNPCTDQNAWQGVNCKKPVIGRVTFLELENLDLPGTIAPNTLSRLDQLRVLRLINVSLSGPIPPDLSSCIHLKQLILLGNKLTGNIPASLGTLAILDRLSLRNNQLEGEIPRELSSLQELQTLRLDYNSLTGPIPDMLFPKMTDFGVSHNRLTGSIPKSLAST

superfamily: SSF52058
31-213 SSF52058,LRR

DQNAWQGVNCKKPVIGRVTFLELENLDLPGTIAPNTLSRLDQLRVLRLINVSLSGPIPPDLSSCIHLKQLILLGNKLTGNIPASLGTLAILDRLSLRNNQLEGEIPRELSSLQELQTLRLDYNSLTGPIPDMLFPKMTDFGVSHNRLTGSIPKSLASTSPTSFAGNDLCGPPTNNSCPPLPSP

HMMPfam: PF00560
IPR001611
121-142 LRR_1
Leucine-rich repeat

LDRLSLRNNQLEGEIPRELSSL

superfamily: SSF56112
IPR011009
304-595 Kinase_like
Protein kinase-like domain

GEAGRLIFAAEDNQHSFGLKELLRASAEMLVPKGTVGTTYKAVLGEGVVFAVKRLIDRNLTEKAEFEKQLALVGRLKHPNLVPLVAYYYYAQEEKLLVYDYLPNKSLYTRLHANRGTNERELLAWPDRLQIAYGVAQGLAFLHRECPTMPHGNLKSTNVVFDGNGQACIADFGLLPFASVQNGPQASDGYRAPEMFVAKKVTHKADVYSFGVMLLELLTGRVAARQGSSVDLPRWVNSTVREEWTAEVFDYELVTYRRNSEEEMVYLLRIALDCVASNPEQRPKMAQVVKLI

ProfileScan: PS50011
IPR000719
328-599 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ASAEMLVPKGTVGTTYKAVLGEGVVFAVKRLIDRNLTEKAEFEKQLALVGRLKHPNLVPLVAYYYYAQEEKLLVYDYLPNKSLYTRLHANRGTNERELLAWPDRLQIAYGVAQGLAFLHRECPTMPHGNLKSTNVVFDGNGQACIADFGLLPFASVQNGPQASDGYRAPEMFVAKKVTHKADVYSFGVMLLELLTGRVAARQGSSVDLPRWVNSTVREEWTAEVFDYELVTYRRNSEEEMVYLLRIALDCVASNPEQRPKMAQVVKLIEDIK

HMMPfam: PF00069
IPR000719
335-593 Pkinase,Ser-thr
Protein kinase, catalytic domain

PKGTVGTTYKAVLGEGVVFAVKRLIDRNLTEKAEFEKQLALVGRLKHPNLVPLVAYYYYAQEEKLLVYDYLPNKSLYTRLHANRGTNERELLAWPDRLQIAYGVAQGLAFLHRECPTMPHGNLKSTNVVFDGNGQACIADFGLLPFASVQNGPQASDGYRAPEMFVAKKVTHKADVYSFGVMLLELLTGRVAARQGSSVDLPRWVNSTVREEWTAEVFDYELVTYRRNSEEEMVYLLRIALDCVASNPEQRPKMAQVVK

Gene3D: G3DSA:3.30.200.20
336-391 G3DSA:3.30.200.20

KGTVGTTYKAVLGEGVVFAVKRLIDRNLTEKAEFEKQLALVGRLKHPNLVPLVAYY

Gene3D: G3DSA:1.10.510.10
392-593 G3DSA:1.10.510.10

YYAQEEKLLVYDYLPNKSLYTRLHANRGTNERELLAWPDRLQIAYGVAQGLAFLHRECPTMPHGNLKSTNVVFDGNGQACIADFGLLPFASVQNGPQASDGYRAPEMFVAKKVTHKADVYSFGVMLLELLTGRVAARQGSSVDLPRWVNSTVREEWTAEVFDYELVTYRRNSEEEMVYLLRIALDCVASNPEQRPKMAQVVK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox