PRGDB00181699 (109282)

From PRG Wiki
Jump to: navigation, search
109282
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Concanavalin A-like lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGAATTTTCTCGACACGATCGACACCAAAGGCCACGCAAATCTTCTCCTCAGGTACATATCTCTCACTCAGATCATCGGCTCCGGGAAGAACAGCGTCGGGCGAGCGTTCTACAATCGCCCCGTCTATCTCTTGGATCAGACCACCGGCAAGGCTCTCTCTTTCCAGACACACTTCGTCTTCCAGATCCTCCACGGTGGAGCTCCCGCCGACGGCATGACGTTCCTCATCTCTCCACACATGAGCTTCGATCTCACAGCGTCGGGTGGCCAGTATCTGGGCTTCAACGCCGAGGGAACCAACGGGAACGCGAGCAACCATCTCTTCGGTGTGGAATTCGACACCTTCTCCAACGAGTGGGATCCTCCGAATCCTCACGTCGGGGTGGACGTGAACGGGGTGAATTCCACTGGCAAGACCATCATCCAGGACGAGCTCGAGCTGAGCCTCGTAAGAAACATGACACTCAAGGCAAGGATAGAGTTCGATGGGAGCTTGGAACAAGTGAAAGTCTGGCTGGTGGAGAATGGATCGGACTGGCAAGAACCGGTTTTGATCACCAACGTGAGCTTGAGCAGCGTTCTACTCCCAGAGATGTGGGTGGGCTTCTCGGCTGCTACAGGTTTCTCAACCGAGCTCCACAACGTTTATAGTTGGTCGTTTTCAGTGGAGGATCCAGCTCCAGCTCCAACCATGGTTTCACCCGAGCTCTCCAGAGGCGACAGAAACAAGGGGGTGATTGTCAAGGCTTCGGTTCCGCTGTCAGTGTTCGCGGTGGCTGTTGCCGGAACGATCGTGATCTATGGTTTCTACCTGGCGAAGAAAGCTACATACCCGTGCGTTCCCCAGATCACAAGCTTCACGTACAGGGAGCTTCACTCGGCAACGAAAGGATTCAGCTCGAAGGAGCTTCTCGGCAAGGGAGGCTCGTGTGTGGTTTACAAGGGATATATCTCCAGCATCGGCTCTCAGGTGGCTGTCAAGGCTTTGTCCGAGGCGCCAAAGCACGCGGAGGCTCAGTTTCTAGCGGAGCTCTCGGTCATCAGCACGGTCCGGCACCACAATCTAGTTTCTCTCCGGGGCTGGTGCAAGGAGAAGAACAAGCTGCTGCTCGTCTACGAGTTCATGGCCAACGGAAGCCTGGATCACTTCATCTTCTCCAAGCAGCCGAGAGTGCTACTGTCGTGGAGCCAGCGCTACGAGATCATGAAAGGTGTGGCCGAGGCGCTGGCCTACCTTCACGAGGGACTCGGCAAGAGGATAGTTCACAGGGACGTGAAAGCAGCGAACGTTCTCCTGGACGAGAACTTCGTCGCAAAGCTGGGGGACTTCGGGCTGGCCAAGTCCATGGAGCATGCCAAAGGCGCGCAGACCATGACGAAGGCCGGGACAGTGGGATACATCGCTCCGGAGCTGGCATTCACAGGCAGAGCTACGGAGAAGTCGGATGTTTACAGCTTTGGGATCCTGGTTTTGGAGATCGTAGCAGGGCGGCAAGCTCTGGACTACACTGTCCAGTCCACGGAAGCCAACATCGCCGCCGACGATTGCCCTGTGCTGATCGACTGGGTGTGGAGGAAGCACGAGCATGACAAGCTTGTGGAAGCCATAGACTCGAGGCTGCAAGTGGAAGGCAAGGAAGAAGAGGTGCTCAAGACGATCAGGATGGGATTGCTGTGCTGCTTGCCGGATGCAAACCATCGCCCAACAATGAAGAGGTGCTGCCAGCTGCTGAATGGAGACGCGGAGATCCCAGCCATGCCGGATTCGAGGCCGCGAGCCGTGTCGATCCGGCTATTTGACGATGAGTATGAGTCGGGCACCGTGAGCTACATGATGGATTGGCAGCGCATCGTTTCGAGCAGCTCAAGCTAA


Protein sequences

Name Description Sequence
109282 Concanavalin A-like lectin protein kinase family protein (best arabidopsis hit)

MNFLDTIDTKGHANLLLRYISLTQIIGSGKNSVGRAFYNRPVYLLDQTTGKALSFQTHFVFQILHGGAPADGMTFLISPHMSFDLTASGGQYLGFNAEGTNGNASNHLFGVEFDTFSNEWDPPNPHVGVDVNGVNSTGKTIIQDELELSLVRNMTLKARIEFDGSLEQVKVWLVENGSDWQEPVLITNVSLSSVLLPEMWVGFSAATGFSTELHNVYSWSFSVEDPAPAPTMVSPELSRGDRNKGVIVKASVPLSVFAVAVAGTIVIYGFYLAKKATYPCVPQITSFTYRELHSATKGFSSKELLGKGGSCVVYKGYISSIGSQVAVKALSEAPKHAEAQFLAELSVISTVRHHNLVSLRGWCKEKNKLLLVYEFMANGSLDHFIFSKQPRVLLSWSQRYEIMKGVAEALAYLHEGLGKRIVHRDVKAANVLLDENFVAKLGDFGLAKSMEHAKGAQTMTKAGTVGYIAPELAFTGRATEKSDVYSFGILVLEIVAGRQALDYTVQSTEANIAADDCPVLIDWVWRKHEHDKLVEAIDSRLQVEGKEEEVLKTIRMGLLCCLPDANHRPTMKRCCQLLNGDAEIPAMPDSRPRAVSIRLFDDEYESGTVSYMMDWQRIVSSSSS*

Domains

Domain Start-End Description Sequence

superfamily: SSF49899
IPR008985
5-244 ConA_like_lec_gl
Concanavalin A-like lectin/glucanase

DTIDTKGHANLLLRYISLTQIIGSGKNSVGRAFYNRPVYLLDQTTGKALSFQTHFVFQILHGGAPADGMTFLISPHMSFDLTASGGQYLGFNAEGTNGNASNHLFGVEFDTFSNEWDPPNPHVGVDVNGVNSTGKTIIQDELELSLVRNMTLKARIEFDGSLEQVKVWLVENGSDWQEPVLITNVSLSSVLLPEMWVGFSAATGFSTELHNVYSWSFSVEDPAPAPTMVSPELSRGDRNK

Gene3D: G3DSA:2.60.120.200
IPR013320
9-231 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

TKGHANLLLRYISLTQIIGSGKNSVGRAFYNRPVYLLDQTTGKALSFQTHFVFQILHGGAPADGMTFLISPHMSFDLTASGGQYLGFNAEGTNGNASNHLFGVEFDTFSNEWDPPNPHVGVDVNGVNSTGKTIIQDELELSLVRNMTLKARIEFDGSLEQVKVWLVENGSDWQEPVLITNVSLSSVLLPEMWVGFSAATGFSTELHNVYSWSFSVEDPAPAPT

HMMPfam: PF00139
IPR001220
12-222 Lectin_legB
Legume lectin domain

HANLLLRYISLTQIIGSGKNSVGRAFYNRPVYLLDQTTGKALSFQTHFVFQILHGGAPADGMTFLISPHMSFDLTASGGQYLGFNAEGTNGNASNHLFGVEFDTFSNEWDPPNPHVGVDVNGVNSTGKTIIQDELELSLVRNMTLKARIEFDGSLEQVKVWLVENGSDWQEPVLITNVSLSSVLLPEMWVGFSAATGFSTELHNVYSWSFS

HMMPanther: PTHR24420
228-614 PTHR24420,FAMILY NOT NAMED

PAPTMVSPELSRGDRNKGVIVKASVPLSVFAVAVAGTIVIYGFYLAKKATYPCVPQITSFTYRELHSATKGFSSKELLGKGGSCVVYKGYISSIGSQVAVKALSEAPKHAEAQFLAELSVISTVRHHNLVSLRGWCKEKNKLLLVYEFMANGSLDHFIFSKQPRVLLSWSQRYEIMKGVAEALAYLHEGLGKRIVHRDVKAANVLLDENFVAKLGDFGLAKSMEHAKGAQTMTKAGTVGYIAPELAFTGRATEKSDVYSFGILVLEIVAGRQALDYTVQSTEANIAADDCPVLIDWVWRKHEHDKLVEAIDSRLQVEGKEEEVLKTIRMGLLCCLPDANHRPTMKRCCQLLNGDAEIPAMPDSRPRAVSIRLFDDEYESGTVSYMMD

superfamily: SSF56112
IPR011009
269-578 Kinase_like
Protein kinase-like domain

GFYLAKKATYPCVPQITSFTYRELHSATKGFSSKELLGKGGSCVVYKGYISSIGSQVAVKALSEAPKHAEAQFLAELSVISTVRHHNLVSLRGWCKEKNKLLLVYEFMANGSLDHFIFSKQPRVLLSWSQRYEIMKGVAEALAYLHEGLGKRIVHRDVKAANVLLDENFVAKLGDFGLAKSMEHAKGAQTMTKAGTVGYIAPELAFTGRATEKSDVYSFGILVLEIVAGRQALDYTVQSTEANIAADDCPVLIDWVWRKHEHDKLVEAIDSRLQVEGKEEEVLKTIRMGLLCCLPDANHRPTMKRCCQLL

Gene3D: G3DSA:3.30.200.20
283-376 G3DSA:3.30.200.20

QITSFTYRELHSATKGFSSKELLGKGGSCVVYKGYISSIGSQVAVKALSEAPKHAEAQFLAELSVISTVRHHNLVSLRGWCKEKNKLLLVYEFM

ProfileScan: PS50011
IPR000719
299-584 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSKELLGKGGSCVVYKGYISSIGSQVAVKALSEAPKHAEAQFLAELSVISTVRHHNLVSLRGWCKEKNKLLLVYEFMANGSLDHFIFSKQPRVLLSWSQRYEIMKGVAEALAYLHEGLGKRIVHRDVKAANVLLDENFVAKLGDFGLAKSMEHAKGAQTMTKAGTVGYIAPELAFTGRATEKSDVYSFGILVLEIVAGRQALDYTVQSTEANIAADDCPVLIDWVWRKHEHDKLVEAIDSRLQVEGKEEEVLKTIRMGLLCCLPDANHRPTMKRCCQLLNGDAEI

HMMPfam: PF07714
IPR001245
302-578 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

KELLGKGGSCVVYKGYISSIGSQVAVKALSEAPKHAEAQFLAELSVISTVRHHNLVSLRGWCKEKNKLLLVYEFMANGSLDHFIFSKQPRVLLSWSQRYEIMKGVAEALAYLHEGLGKRIVHRDVKAANVLLDENFVAKLGDFGLAKSMEHAKGAQTMTKAGTVGYIAPELAFTGRATEKSDVYSFGILVLEIVAGRQALDYTVQSTEANIAADDCPVLIDWVWRKHEHDKLVEAIDSRLQVEGKEEEVLKTIRMGLLCCLPDANHRPTMKRCCQLL

Gene3D: G3DSA:1.10.510.10
377-576 G3DSA:1.10.510.10

ANGSLDHFIFSKQPRVLLSWSQRYEIMKGVAEALAYLHEGLGKRIVHRDVKAANVLLDENFVAKLGDFGLAKSMEHAKGAQTMTKAGTVGYIAPELAFTGRATEKSDVYSFGILVLEIVAGRQALDYTVQSTEANIAADDCPVLIDWVWRKHEHDKLVEAIDSRLQVEGKEEEVLKTIRMGLLCCLPDANHRPTMKRCCQ

PatternScan: PS00108
IPR008271
421-433 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKAANVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox