PRGDB00181806 (109362)

From PRG Wiki
Jump to: navigation, search
109362
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Selaginella moellendorffii

Comment?

receptor like protein 47 (best arabidopsis hit)

DNA Sequence

ATGAGGCTGAGCTCCAACATCATCACTGGAAGAATCCCACCGGAGCTCGGCCAGCTGACCCAAGTCACGGGGCTCTACCTGGACGACAACGCGATTGCGGGCGAGATCCCGCGCAGCCTCGCCAACCTCACGAGCTTGCAGAGGATGAATCTCGCCCAGAATCGCTTGACAGGCAAGATTCCAGTGGAATTCCTGGCGCTCAAGCGCCTGCGCTACTTGAACGTCTCCCACAATCAGCTCACTGGCGCCATACCTGATGGAGCGCCGCTGAGCACCATGGATCCGGAGAACTTCGCCGGCAATCCGGGGCTCTGCGGCAAGCCCCTGTCTCCATGCCCCACGAAACCCTAG


Protein sequences

Name Description Sequence
109362 receptor like protein 47 (best arabidopsis hit)

MRLSSNIITGRIPPELGQLTQVTGLYLDDNAIAGEIPRSLANLTSLQRMNLAQNRLTGKIPVEFLALKRLRYLNVSHNQLTGAIPDGAPLSTMDPENFAGNPGLCGKPLSPCPTKP*

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-113 SSF52058,LRR

MRLSSNIITGRIPPELGQLTQVTGLYLDDNAIAGEIPRSLANLTSLQRMNLAQNRLTGKIPVEFLALKRLRYLNVSHNQLTGAIPDGAPLSTMDPENFAGNPGLCGKPLSPCP

HMMPanther: PTHR24420
1-111 PTHR24420,FAMILY NOT NAMED

MRLSSNIITGRIPPELGQLTQVTGLYLDDNAIAGEIPRSLANLTSLQRMNLAQNRLTGKIPVEFLALKRLRYLNVSHNQLTGAIPDGAPLSTMDPENFAGNPGLCGKPLSP

Gene3D: G3DSA:3.80.10.10
2-111 G3DSA:3.80.10.10

RLSSNIITGRIPPELGQLTQVTGLYLDDNAIAGEIPRSLANLTSLQRMNLAQNRLTGKIPVEFLALKRLRYLNVSHNQLTGAIPDGAPLSTMDPENFAGNPGLCGKPLSP

HMMPfam: PF13855
22-80 LRR_8,Leucine rich repeat

VTGLYLDDNAIAGEIPRSLANLTSLQRMNLAQNRLTGKIPVEFLALKRLRYLNVSHNQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox