PRGDB00181947 (110120)

From PRG Wiki
Jump to: navigation, search
110120
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase, NBS
Gene Species Selaginella moellendorffii

Comment?

serine/threonine protein kinase 2 (best arabidopsis hit)

DNA Sequence

ATCGAGGAGTTTGAGCTCGGGCGTGTCCTGGGGACTGGCAGCTTTGGCCGCGTCCAAGTAGCACACCACAAGGCCAACAAGCAAGTTTGTGCTGTTAAGTCTTTGTCAAAGGCGTCTATTGTCAAGACAAAGCAGGCATGTGAACACTCCTTCCAGAAGAACATTCTTCAGAGGCTTGACTTCCCGTACATTGTTAATCTGCTGGGATATTGCCAAGACGACAGATGTGTCCACCTCGTCATGGAATACGTTTGCGGCGGTGAGTTTTTTACTTATCTTCGCCACACGGGTCGATTTGATGAAGCAACATCTAGATTCTATGCTTCTCAAGTTCTTCTCGCCTTCGAACATATCCATGGAATGGATATTATCTATCGTGACTTGAAGCCTGAAAATTTGCTTCTTGACGAGAAGGGAAACATTAAGATAGCCGACTTTGGTTTTGCAAAGCAAATTGACAGAAGAACGTATACTCTATGCGGAACGCCTGACTATTTGGCTCCAGAGATCATTCTCAACAAAGGTCACGGAAAACCTGTTGACTGGTGGGCCTTTGGCGTTTTGATTTACGAGATGCTCGCAGGGTATCCTCCATTCTACGATGATGATGCTATTGGAACATATCAGAAGATCTTAGCGGGTAAATTACAATTTCCAGGACACTTTTCCCGCAGGCAGACATCCTGCAGTGCGAAGGATCTCGTAAGAAGGCTTCTCACTGCAGATCTCACCAAGCGGATTGGCTGTCTGAAGGATGGTGTGGATGAAATAAAAAATCATTCTTGGTTTGCGAACGTGAAGTGGGACAATGTCCTTGCTAAAAAAGACACTCCGCCAATAAGGCCGAAAGTAGCGGTATGTCTTTATTTTCTCATTTAG


Protein sequences

Name Description Sequence
110120 serine/threonine protein kinase 2 (best arabidopsis hit)

IEEFELGRVLGTGSFGRVQVAHHKANKQVCAVKSLSKASIVKTKQACEHSFQKNILQRLDFPYIVNLLGYCQDDRCVHLVMEYVCGGEFFTYLRHTGRFDEATSRFYASQVLLAFEHIHGMDIIYRDLKPENLLLDEKGNIKIADFGFAKQIDRRTYTLCGTPDYLAPEIILNKGHGKPVDWWAFGVLIYEMLAGYPPFYDDDAIGTYQKILAGKLQFPGHFSRRQTSCSAKDLVRRLLTADLTKRIGCLKDGVDEIKNHSWFANVKWDNVLAKKDTPPIRPKVAVCLYFLI*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24353
1-285 PTHR24353,CYCLIC NUCLEOTIDE-DEPENDENT PROTEIN KINASE

IEEFELGRVLGTGSFGRVQVAHHKANKQVCAVKSLSKASIVKTKQACEHSFQKNILQRLDFPYIVNLLGYCQDDRCVHLVMEYVCGGEFFTYLRHTGRFDEATSRFYASQVLLAFEHIHGMDIIYRDLKPENLLLDEKGNIKIADFGFAKQIDRRTYTLCGTPDYLAPEIILNKGHGKPVDWWAFGVLIYEMLAGYPPFYDDDAIGTYQKILAGKLQFPGHFSRRQTSCSAKDLVRRLLTADLTKRIGCLKDGVDEIKNHSWFANVKWDNVLAKKDTPPIRPKVA

Gene3D: G3DSA:3.30.200.20
1-111 G3DSA:3.30.200.20

IEEFELGRVLGTGSFGRVQVAHHKANKQVCAVKSLSKASIVKTKQACEHSFQKNILQRLDFPYIVNLLGYCQDDRCVHLVMEYVCGGEFFTYLRHTGRFDEATSRFYASQV

superfamily: SSF56112
IPR011009
2-290 Kinase_like
Protein kinase-like domain

EEFELGRVLGTGSFGRVQVAHHKANKQVCAVKSLSKASIVKTKQACEHSFQKNILQRLDFPYIVNLLGYCQDDRCVHLVMEYVCGGEFFTYLRHTGRFDEATSRFYASQVLLAFEHIHGMDIIYRDLKPENLLLDEKGNIKIADFGFAKQIDRRTYTLCGTPDYLAPEIILNKGHGKPVDWWAFGVLIYEMLAGYPPFYDDDAIGTYQKILAGKLQFPGHFSRRQTSCSAKDLVRRLLTADLTKRIGCLKDGVDEIKNHSWFANVKWDNVLAKKDTPPIRPKVAVCLYF

HMMPfam: PF00069
IPR000719
4-263 Pkinase,Ser-thr
Protein kinase, catalytic domain

FELGRVLGTGSFGRVQVAHHKANKQVCAVKSLSKASIVKTKQACEHSFQKNILQRLDFPYIVNLLGYCQDDRCVHLVMEYVCGGEFFTYLRHTGRFDEATSRFYASQVLLAFEHIHGMDIIYRDLKPENLLLDEKGNIKIADFGFAKQIDRRTYTLCGTPDYLAPEIILNKGHGKPVDWWAFGVLIYEMLAGYPPFYDDDAIGTYQKILAGKLQFPGHFSRRQTSCSAKDLVRRLLTADLTKRIGCLKDGVDEIKNHSWF

ProfileScan: PS50011
IPR000719
4-263 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FELGRVLGTGSFGRVQVAHHKANKQVCAVKSLSKASIVKTKQACEHSFQKNILQRLDFPYIVNLLGYCQDDRCVHLVMEYVCGGEFFTYLRHTGRFDEATSRFYASQVLLAFEHIHGMDIIYRDLKPENLLLDEKGNIKIADFGFAKQIDRRTYTLCGTPDYLAPEIILNKGHGKPVDWWAFGVLIYEMLAGYPPFYDDDAIGTYQKILAGKLQFPGHFSRRQTSCSAKDLVRRLLTADLTKRIGCLKDGVDEIKNHSWF

HMMSmart: SM00220
IPR002290
4-263 S_TKc
Serine/threonine- / dual-specificity protein kinas

FELGRVLGTGSFGRVQVAHHKANKQVCAVKSLSKASIVKTKQACEHSFQKNILQRLDFPYIVNLLGYCQDDRCVHLVMEYVCGGEFFTYLRHTGRFDEATSRFYASQVLLAFEHIHGMDIIYRDLKPENLLLDEKGNIKIADFGFAKQIDRRTYTLCGTPDYLAPEIILNKGHGKPVDWWAFGVLIYEMLAGYPPFYDDDAIGTYQKILAGKLQFPGHFSRRQTSCSAKDLVRRLLTADLTKRIGCLKDGVDEIKNHSWF

PatternScan: PS00107
IPR017441
10-42 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGTGSFGRVQVAHHKANKQVCAVKSLSKASIVK

Gene3D: G3DSA:1.10.510.10
112-271 G3DSA:1.10.510.10

LLAFEHIHGMDIIYRDLKPENLLLDEKGNIKIADFGFAKQIDRRTYTLCGTPDYLAPEIILNKGHGKPVDWWAFGVLIYEMLAGYPPFYDDDAIGTYQKILAGKLQFPGHFSRRQTSCSAKDLVRRLLTADLTKRIGCLKDGVDEIKNHSWFANVKWDNV

PatternScan: PS00108
IPR008271
123-135 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIYRDLKPENLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox