PRGDB00181997 (109677)

From PRG Wiki
Jump to: navigation, search
109677
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

S-domain-2 5 (best arabidopsis hit)

DNA Sequence

ATGGAGCTGGATCTCGTCTTGAGCGGCATCCAGGGGCTGCCACAGCGATTCCAATACTCCGTTCTGGAGGCCGCGACGTGGGGATTCTCCAGGAAGCTTGGAGCTGGAGGATTTGGCTCGGTCTACGAGGGATTCCTGGAGGATGGCAAGAGAAGCATCGCGGTGAAGAAGCTCGAGGGCGCCAGCGCGCAGGGCGCGCGGCAATTCATCGCCGAGGTCGCGACCATCGGCAGCATCAGCCACATCAACGTCGTCAAGCTCTGTGGATTCTGCGTGGAGGGATGCCACCGGATGCTCGTCTACGAGTTCATGCCCAATGGCTCGCTCGATCGCTGGCTCTTCGTCTCGAATCAAACACCGGAGCATCCGCGAGGAGTCCTGAGCTGGGATCGCCGGGTGGAAATCGCGCTGGGCACTGCTCGCGGGCTGGCCTATCTCCACGAGGAATGCCGCGAGCCCATAATCCACCTGGACGTGAAGCCCCAGAATATCCTCCTGGATGAACGGTTCGTGGCCAAGGTCGCGGATTTCGGAATGTCCAAGCTGCTGGGCGGCCGCGATGTGAGCCACGTGGTGACGTGCGTGAGGGGGACGCCTGGTTATTTGGCCCCGGAATGGCTGCTCCATTCCATCGCGACCAAGAAATGCGATGTCTATAGCTTCGGCATGGTTCTCCTGGAGATCATTGGCGGGCGGAAGAATCTCGAGGTTTCCAGGATGAACAGCGATCTGGCGTGGTACTTCCCGGCGTGGGTCGTGAACGAGGTCAGGGAGGGGCGATTGATGGAGATTGTGGACGAGAGGATTAGGGCTCTTGTGAGCGAGAAGGCGGCGGCGCAGATGATCCGGATCGCGCTGTGGTGCGTCCAGGAGAGCGCGGCGTCGCGGCCGACGATGCCCGAGATCGTCCAGATGATCGAGGGGCACAGGGATGTGGAGGAGCCGCCCATGGCGTTCCATTTCGCGGTCCAGACAATGGTGGACATCACGGCGTCCAGGGATTGCTTGTCCATGGCCTATGTCACTCCTCCCAGCTTCGATGTCTCGAGCTTGATCCGGTGA


Protein sequences

Name Description Sequence
109677 S-domain-2 5 (best arabidopsis hit)

MELDLVLSGIQGLPQRFQYSVLEAATWGFSRKLGAGGFGSVYEGFLEDGKRSIAVKKLEGASAQGARQFIAEVATIGSISHINVVKLCGFCVEGCHRMLVYEFMPNGSLDRWLFVSNQTPEHPRGVLSWDRRVEIALGTARGLAYLHEECREPIIHLDVKPQNILLDERFVAKVADFGMSKLLGGRDVSHVVTCVRGTPGYLAPEWLLHSIATKKCDVYSFGMVLLEIIGGRKNLEVSRMNSDLAWYFPAWVVNEVREGRLMEIVDERIRALVSEKAAAQMIRIALWCVQESAASRPTMPEIVQMIEGHRDVEEPPMAFHFAVQTMVDITASRDCLSMAYVTPPSFDVSSLIR*

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
14-104 G3DSA:3.30.200.20

PQRFQYSVLEAATWGFSRKLGAGGFGSVYEGFLEDGKRSIAVKKLEGASAQGARQFIAEVATIGSISHINVVKLCGFCVEGCHRMLVYEFM

superfamily: SSF56112
IPR011009
15-337 Kinase_like
Protein kinase-like domain

QRFQYSVLEAATWGFSRKLGAGGFGSVYEGFLEDGKRSIAVKKLEGASAQGARQFIAEVATIGSISHINVVKLCGFCVEGCHRMLVYEFMPNGSLDRWLFVSNQTPEHPRGVLSWDRRVEIALGTARGLAYLHEECREPIIHLDVKPQNILLDERFVAKVADFGMSKLLGGRDVSHVVTCVRGTPGYLAPEWLLHSIATKKCDVYSFGMVLLEIIGGRKNLEVSRMNSDLAWYFPAWVVNEVREGRLMEIVDERIRALVSEKAAAQMIRIALWCVQESAASRPTMPEIVQMIEGHRDVEEPPMAFHFAVQTMVDITASRDCLS

HMMPanther: PTHR24420:SF442
16-317 PTHR24420:SF442,SUBFAMILY NOT NAMED

RFQYSVLEAATWGFSRKLGAGGFGSVYEGFLEDGKRSIAVKKLEGASAQGARQFIAEVATIGSISHINVVKLCGFCVEGCHRMLVYEFMPNGSLDRWLFVSNQTPEHPRGVLSWDRRVEIALGTARGLAYLHEECREPIIHLDVKPQNILLDERFVAKVADFGMSKLLGGRDVSHVVTCVRGTPGYLAPEWLLHSIATKKCDVYSFGMVLLEIIGGRKNLEVSRMNSDLAWYFPAWVVNEVREGRLMEIVDERIRALVSEKAAAQMIRIALWCVQESAASRPTMPEIVQMIEGHRDVEEPPM

HMMPanther: PTHR24420
16-317 PTHR24420,FAMILY NOT NAMED

RFQYSVLEAATWGFSRKLGAGGFGSVYEGFLEDGKRSIAVKKLEGASAQGARQFIAEVATIGSISHINVVKLCGFCVEGCHRMLVYEFMPNGSLDRWLFVSNQTPEHPRGVLSWDRRVEIALGTARGLAYLHEECREPIIHLDVKPQNILLDERFVAKVADFGMSKLLGGRDVSHVVTCVRGTPGYLAPEWLLHSIATKKCDVYSFGMVLLEIIGGRKNLEVSRMNSDLAWYFPAWVVNEVREGRLMEIVDERIRALVSEKAAAQMIRIALWCVQESAASRPTMPEIVQMIEGHRDVEEPPM

ProfileScan: PS50011
IPR000719
27-312 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

WGFSRKLGAGGFGSVYEGFLEDGKRSIAVKKLEGASAQGARQFIAEVATIGSISHINVVKLCGFCVEGCHRMLVYEFMPNGSLDRWLFVSNQTPEHPRGVLSWDRRVEIALGTARGLAYLHEECREPIIHLDVKPQNILLDERFVAKVADFGMSKLLGGRDVSHVVTCVRGTPGYLAPEWLLHSIATKKCDVYSFGMVLLEIIGGRKNLEVSRMNSDLAWYFPAWVVNEVREGRLMEIVDERIRALVSEKAAAQMIRIALWCVQESAASRPTMPEIVQMIEGHRDV

HMMPfam: PF00069
IPR000719
30-304 Pkinase,Ser-thr
Protein kinase, catalytic domain

SRKLGAGGFGSVYEGFLEDGKRSIAVKKLEGASAQGARQFIAEVATIGSISHINVVKLCGFCVEGCHRMLVYEFMPNGSLDRWLFVSNQTPEHPRGVLSWDRRVEIALGTARGLAYLHEECREPIIHLDVKPQNILLDERFVAKVADFGMSKLLGGRDVSHVVTCVRGTPGYLAPEWLLHSIATKKCDVYSFGMVLLEIIGGRKNLEVSRMNSDLAWYFPAWVVNEVREGRLMEIVDERIRALVSEKAAAQMIRIALWCVQESAASRPTMPEIVQ

PatternScan: PS00107
IPR017441
33-57 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGAGGFGSVYEGFLEDGKRSIAVKK

Gene3D: G3DSA:1.10.510.10
108-315 G3DSA:1.10.510.10

SLDRWLFVSNQTPEHPRGVLSWDRRVEIALGTARGLAYLHEECREPIIHLDVKPQNILLDERFVAKVADFGMSKLLGGRDVSHVVTCVRGTPGYLAPEWLLHSIATKKCDVYSFGMVLLEIIGGRKNLEVSRMNSDLAWYFPAWVVNEVREGRLMEIVDERIRALVSEKAAAQMIRIALWCVQESAASRPTMPEIVQMIEGHRDVEEP

PatternScan: PS00108
IPR008271
154-166 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHLDVKPQNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox