PRGDB00182097 (109804)

From PRG Wiki
Jump to: navigation, search
109804
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

flower-specific, phytochrome-associated protein phosphatase 3 (best arabidopsis hit)

DNA Sequence

ATGGGTAGCTCCAGGTCGTTGTTCACTTACGAGGAACTTGAGGCAGCGACTGCTGGATTCTCCAGGGCCAATCTTCTCGGCGAGGGTGGGTTTGGATGTGTATACAAGGGATTTCTCCATGGTGGTCAAGTTGTAGCTGTGAAGCAGCTTAGAGATGGAAGCAGGCAAGGAGAGCGTGAGTTTCGAGCTGAGGTTGAGATTATTAGCAGAGTTCATCACAGGCATCTGGTTTCGCTGGTTGGATACTGCATTGAGGATGCTCAGAGGCTGCTGGTTTACGATTTCGTGCCGAATGGAACGCTGGAGCATCACCTGCACGGTGAAGGTAGAACCGTGATGGATTGGCCAACGAGATTGAAAATAGCTTCTGGTTCTGCTCGTGGACTAGCATATCTTCATGAAGACTGCCATCCTCGAATCATTCATCGGGACATAAAGTCGTCTAACATTCTTTTGGATAACAATTTTGACGCTCAGGTCTCTGACTTTGGGCTTGCGAAGCTCGCTTCTGACACTTACACACACGTCACTACTCGAGTTATGGGAACCTTCGGGTACCTTGCGCCTGAGTACGCCTCCACAGGAAAACTGACGGAGAAGTCAGACGTGTACTCCTTTGGAGTCGTCCTACTGGAACTTATAACGGGAAGGAGGCCTGTAGATACCACGCAACCTGTGGGAAAAGACAGCTTGGTCGAATGGGCTCGACCATACCTCATGCAGGCTATCGAGAATGGCGACCTCGGTGGCGTAGTCGACGAAAGACTAGCAAACTACAACGAGAACGAGATGCTACGAATGGTCGAGGCAGCTGCAGCCTGCGTTCGACACTCAGCCAGAGAACGCCCAAGGATGGCAGAGGTTGTCCCCGCTCTAAAAAGCGATATCTCCGACCTCAACCAAGGAGTAAAGCCAGGCCACAACTCGAACTTCACGAGTGCGGACTACAATAGCAACCAATACGTCTCAGACATGAAAAGGTTCCAAAAGGTGGTGTTTGGAAGCCAAGAACACGGGAGCTCCGAACACAGTGGCCCGCCGACGAGCGATCCCTCGGTGTCGAGCAGTGAAGGGATGAGCAGCATGGAGATGGAGAGGCGGCGGGCTGGGTTGCTTTGGAGCTCGGACACGACGAGTTCCAGTGAGATCAATGCCAACACCAACAGCAGTAATCGTCTCAATGGCCGGTAA


Protein sequences

Name Description Sequence
109804 flower-specific, phytochrome-associated protein phosphatase 3 (best arabidopsis hit)

MGSSRSLFTYEELEAATAGFSRANLLGEGGFGCVYKGFLHGGQVVAVKQLRDGSRQGEREFRAEVEIISRVHHRHLVSLVGYCIEDAQRLLVYDFVPNGTLEHHLHGEGRTVMDWPTRLKIASGSARGLAYLHEDCHPRIIHRDIKSSNILLDNNFDAQVSDFGLAKLASDTYTHVTTRVMGTFGYLAPEYASTGKLTEKSDVYSFGVVLLELITGRRPVDTTQPVGKDSLVEWARPYLMQAIENGDLGGVVDERLANYNENEMLRMVEAAAACVRHSARERPRMAEVVPALKSDISDLNQGVKPGHNSNFTSADYNSNQYVSDMKRFQKVVFGSQEHGSSEHSGPPTSDPSVSSSEGMSSMEMERRRAGLLWSSDTTSSSEINANTNSSNRLNGR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
3-368 PTHR24420,FAMILY NOT NAMED

SSRSLFTYEELEAATAGFSRANLLGEGGFGCVYKGFLHGGQVVAVKQLRDGSRQGEREFRAEVEIISRVHHRHLVSLVGYCIEDAQRLLVYDFVPNGTLEHHLHGEGRTVMDWPTRLKIASGSARGLAYLHEDCHPRIIHRDIKSSNILLDNNFDAQVSDFGLAKLASDTYTHVTTRVMGTFGYLAPEYASTGKLTEKSDVYSFGVVLLELITGRRPVDTTQPVGKDSLVEWARPYLMQAIENGDLGGVVDERLANYNENEMLRMVEAAAACVRHSARERPRMAEVVPALKSDISDLNQGVKPGHNSNFTSADYNSNQYVSDMKRFQKVVFGSQEHGSSEHSGPPTSDPSVSSSEGMSSMEMERRR

HMMPanther: PTHR24420:SF644
3-368 PTHR24420:SF644

SSRSLFTYEELEAATAGFSRANLLGEGGFGCVYKGFLHGGQVVAVKQLRDGSRQGEREFRAEVEIISRVHHRHLVSLVGYCIEDAQRLLVYDFVPNGTLEHHLHGEGRTVMDWPTRLKIASGSARGLAYLHEDCHPRIIHRDIKSSNILLDNNFDAQVSDFGLAKLASDTYTHVTTRVMGTFGYLAPEYASTGKLTEKSDVYSFGVVLLELITGRRPVDTTQPVGKDSLVEWARPYLMQAIENGDLGGVVDERLANYNENEMLRMVEAAAACVRHSARERPRMAEVVPALKSDISDLNQGVKPGHNSNFTSADYNSNQYVSDMKRFQKVVFGSQEHGSSEHSGPPTSDPSVSSSEGMSSMEMERRR

superfamily: SSF56112
IPR011009
3-292 Kinase_like
Protein kinase-like domain

SSRSLFTYEELEAATAGFSRANLLGEGGFGCVYKGFLHGGQVVAVKQLRDGSRQGEREFRAEVEIISRVHHRHLVSLVGYCIEDAQRLLVYDFVPNGTLEHHLHGEGRTVMDWPTRLKIASGSARGLAYLHEDCHPRIIHRDIKSSNILLDNNFDAQVSDFGLAKLASDTYTHVTTRVMGTFGYLAPEYASTGKLTEKSDVYSFGVVLLELITGRRPVDTTQPVGKDSLVEWARPYLMQAIENGDLGGVVDERLANYNENEMLRMVEAAAACVRHSARERPRMAEVVPAL

Gene3D: G3DSA:3.30.200.20
5-96 G3DSA:3.30.200.20

RSLFTYEELEAATAGFSRANLLGEGGFGCVYKGFLHGGQVVAVKQLRDGSRQGEREFRAEVEIISRVHHRHLVSLVGYCIEDAQRLLVYDFV

ProfileScan: PS50011
IPR000719
20-292 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSRANLLGEGGFGCVYKGFLHGGQVVAVKQLRDGSRQGEREFRAEVEIISRVHHRHLVSLVGYCIEDAQRLLVYDFVPNGTLEHHLHGEGRTVMDWPTRLKIASGSARGLAYLHEDCHPRIIHRDIKSSNILLDNNFDAQVSDFGLAKLASDTYTHVTTRVMGTFGYLAPEYASTGKLTEKSDVYSFGVVLLELITGRRPVDTTQPVGKDSLVEWARPYLMQAIENGDLGGVVDERLANYNENEMLRMVEAAAACVRHSARERPRMAEVVPAL

HMMPfam: PF07714
IPR001245
24-291 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NLLGEGGFGCVYKGFLHGGQVVAVKQLRDGSRQGEREFRAEVEIISRVHHRHLVSLVGYCIEDAQRLLVYDFVPNGTLEHHLHGEGRTVMDWPTRLKIASGSARGLAYLHEDCHPRIIHRDIKSSNILLDNNFDAQVSDFGLAKLASDTYTHVTTRVMGTFGYLAPEYASTGKLTEKSDVYSFGVVLLELITGRRPVDTTQPVGKDSLVEWARPYLMQAIENGDLGGVVDERLANYNENEMLRMVEAAAACVRHSARERPRMAEVVPA

PatternScan: PS00107
IPR017441
26-48 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGCVYKGFLHGGQVVAVK

Gene3D: G3DSA:1.10.510.10
98-323 G3DSA:1.10.510.10

NGTLEHHLHGEGRTVMDWPTRLKIASGSARGLAYLHEDCHPRIIHRDIKSSNILLDNNFDAQVSDFGLAKLASDTYTHVTTRVMGTFGYLAPEYASTGKLTEKSDVYSFGVVLLELITGRRPVDTTQPVGKDSLVEWARPYLMQAIENGDLGGVVDERLANYNENEMLRMVEAAAACVRHSARERPRMAEVVPALKSDISDLNQGVKPGHNSNFTSADYNSNQYVS

PatternScan: PS00108
IPR008271
140-152 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox