PRGDB00182491 (105865)

From PRG Wiki
Jump to: navigation, search
105865
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Selaginella moellendorffii

Comment?

TBP-associated factor 15 (best arabidopsis hit)

DNA Sequence

ATGCCAGTGAGCGAGAAGCTGGAGGAGATCATCCGGCTGCTCAAGGACCCGGAGAAGGGGAAGTGGATTGGCATCTGCGGGATGGGTGGATCCGGCAAGACCACCCTCGCAAGCCTGGTGAACAACGACGCCAGAGTTCACGAGCACTTCGAAGGCCGCGTCTACTTCCTGGGCGTCCATCGCAACGCGAGCGTGGAGAACTTGCAGAGGGCGCTCTTCAACCTCCTGGACGATGATCGCGGGAGAGCTCTCGATCAGCCCAAGTCGACGCTGCATGATCTTCTGGGCGGCCAGAGAACGCTGCTCATACTGGACGATGTCTGGGAAGGCGCGGTGTTGGATGGGCTCGACGTCCTGGATCGAGCAAACGGGAGCAAGATGCTCGTCACCACGCGAAACTCCGGGCTGCTCGAGCGGAGGAAGGCGGAAGTGATTACCTCGGCGGGGCTTCTCTCGAGCGCGGATAACAAGAAGTTCTTTTGCATGCACGCTTTCCAGGACGCCGGGAGCGAGCAGCCGGGGATTGATGATCTCGTGGGCGAGATGGCGGCGGCGTGCAAGGGACTCCCGCTCGCGCTCAAGGTG


Protein sequences

Name Description Sequence
105865 TBP-associated factor 15 (best arabidopsis hit)

MPVSEKLEEIIRLLKDPEKGKWIGICGMGGSGKTTLASLVNNDARVHEHFEGRVYFLGVHRNASVENLQRALFNLLDDDRGRALDQPKSTLHDLLGGQRTLLILDDVWEGAVLDGLDVLDRANGSKMLVTTRNSGLLERRKAEVITSAGLLSSADNKKFFCMHAFQDAGSEQPGIDDLVGEMAAACKGLPLALKV

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
3-195 SSF52540

VSEKLEEIIRLLKDPEKGKWIGICGMGGSGKTTLASLVNNDARVHEHFEGRVYFLGVHRNASVENLQRALFNLLDDDRGRALDQPKSTLHDLLGGQRTLLILDDVWEGAVLDGLDVLDRANGSKMLVTTRNSGLLERRKAEVITSAGLLSSADNKKFFCMHAFQDAGSEQPGIDDLVGEMAAACKGLPLALKV

Gene3D: G3DSA:3.40.50.300
7-47 G3DSA:3.40.50.300

LEEIIRLLKDPEKGKWIGICGMGGSGKTTLASLVNNDARVH

HMMPfam: PF00931
IPR002182
7-195 NB-ARC,NBS
NB-ARC

LEEIIRLLKDPEKGKWIGICGMGGSGKTTLASLVNNDARVHEHFEGRVYFLGVHRNASVENLQRALFNLLDDDRGRALDQPKSTLHDLLGGQRTLLILDDVWEGAVLDGLDVLDRANGSKMLVTTRNSGLLERRKAEVITSAGLLSSADNKKFFCMHAFQDAGSEQPGIDDLVGEMAAACKGLPLALKV

FPrintScan: PR00364
IPR000767
22-37 DISEASERSIST
Disease resistance protein

WIGICGMGGSGKTTLA

HMMPanther: PTHR11017:SF20
23-195 PTHR11017:SF20,SUBFAMILY NOT NAMED

IGICGMGGSGKTTLASLVNNDARVHEHFEGRVYFLGVHRNASVENLQRALFNLLDDDRGRALDQPKSTLHDLLGGQRTLLILDDVWEGAVLDGLDVLDRANGSKMLVTTRNSGLLERRKAEVITSAGLLSSADNKKFFCMHAFQDAGSEQPGIDDLVGEMAAACKGLPLALKV

HMMPanther: PTHR11017
23-195 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

IGICGMGGSGKTTLASLVNNDARVHEHFEGRVYFLGVHRNASVENLQRALFNLLDDDRGRALDQPKSTLHDLLGGQRTLLILDDVWEGAVLDGLDVLDRANGSKMLVTTRNSGLLERRKAEVITSAGLLSSADNKKFFCMHAFQDAGSEQPGIDDLVGEMAAACKGLPLALKV

FPrintScan: PR00364
IPR000767
94-108 DISEASERSIST
Disease resistance protein

LLGGQRTLLILDDVW

FPrintScan: PR00364
IPR000767
186-195 DISEASERSIST
Disease resistance protein

CKGLPLALKV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox