PRGDB00182509 (78054)

From PRG Wiki
Jump to: navigation, search
78054
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

CRINKLY4 related 1 (best arabidopsis hit)

DNA Sequence

ATGTTCAGAGGAGTTTTGCCCAACCAGCAGCTCGTTCTGATACAACGGTGCATGCGTTCGTGCGAGAAGGAATTCGAGCTTTTGTCAAGGATCAAGCATTCCAACGTGGCCTCCGTCTTGGGTGTCTGCTACGACATCAGCGAAAGCTTCCTCATTTTCAAAGACATGTGCCACAGCTCCGTCTTCAGCCATCTCTTTGACGACGACAAGTGCTCGGCTCTTTCGTGGGAACGCAGGGTGAAAGTTGCTACGCAAGTCGCGAGAGCTCTGGGATACTTGCATACGTTTGCGGAGCCTTGCGTGGTTCACCGGTCAGTGAGCTCCATCAACGTCTACCTGGACGGTTCCTGGAATGCCAAGCTCGCGGGATTCGGCAGCGCTTTGAGTGTACGTTCCAGGAGCCAGGAACTCAAGCTGAAAGCCGAAGACGTTTACAGGGTGGGAGTTTTTATCTTGGAGCTGCTCATGGGACAGAGTGCTTTGAACGCAGAAGAGGACCAGCCAACAGTCGTTGCCCGCTGGGCTGTTCATGTTATCGACACAGGGTCCGGCTACGAAATTTTGGACAGGAGGTTGGAGGTGCCATGCGAACGAGAAAGAAGTGCGCGAGCTTTGCTGAAAATGGCGGAGATAGGTGCCTGGTGTATGAAGGACAAGCCGGAGGACAGACCGAACATGATGGAGGTGGCGGCGGTGTTGGCGCAGGTGGAAACTATTTTCTTTGGTCAATCCAAGCGGCATAGTAAGCGTCCAGGCTGA


Protein sequences

Name Description Sequence
78054 CRINKLY4 related 1 (best arabidopsis hit)

MFRGVLPNQQLVLIQRCMRSCEKEFELLSRIKHSNVASVLGVCYDISESFLIFKDMCHSSVFSHLFDDDKCSALSWERRVKVATQVARALGYLHTFAEPCVVHRSVSSINVYLDGSWNAKLAGFGSALSVRSRSQELKLKAEDVYRVGVFILELLMGQSALNAEEDQPTVVARWAVHVIDTGSGYEILDRRLEVPCERERSARALLKMAEIGAWCMKDKPEDRPNMMEVAAVLAQVETIFFGQSKRHSKRPG*

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-241 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MFRGVLPNQQLVLIQRCMRSCEKEFELLSRIKHSNVASVLGVCYDISESFLIFKDMCHSSVFSHLFDDDKCSALSWERRVKVATQVARALGYLHTFAEPCVVHRSVSSINVYLDGSWNAKLAGFGSALSVRSRSQELKLKAEDVYRVGVFILELLMGQSALNAEEDQPTVVARWAVHVIDTGSGYEILDRRLEVPCERERSARALLKMAEIGAWCMKDKPEDRPNMMEVAAVLAQVETIFF

HMMPanther: PTHR24420
2-233 PTHR24420,FAMILY NOT NAMED

FRGVLPNQQLVLIQRCMRSCEKEFELLSRIKHSNVASVLGVCYDISESFLIFKDMCHSSVFSHLFDDDKCSALSWERRVKVATQVARALGYLHTFAEPCVVHRSVSSINVYLDGSWNAKLAGFGSALSVRSRSQELKLKAEDVYRVGVFILELLMGQSALNAEEDQPTVVARWAVHVIDTGSGYEILDRRLEVPCERERSARALLKMAEIGAWCMKDKPEDRPNMMEVAAVL

superfamily: SSF56112
IPR011009
18-233 Kinase_like
Protein kinase-like domain

MRSCEKEFELLSRIKHSNVASVLGVCYDISESFLIFKDMCHSSVFSHLFDDDKCSALSWERRVKVATQVARALGYLHTFAEPCVVHRSVSSINVYLDGSWNAKLAGFGSALSVRSRSQELKLKAEDVYRVGVFILELLMGQSALNAEEDQPTVVARWAVHVIDTGSGYEILDRRLEVPCERERSARALLKMAEIGAWCMKDKPEDRPNMMEVAAVL

Gene3D: G3DSA:3.30.200.20
19-76 G3DSA:3.30.200.20

RSCEKEFELLSRIKHSNVASVLGVCYDISESFLIFKDMCHSSVFSHLFDDDKCSALSW

HMMPfam: PF07714
IPR001245
20-136 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SCEKEFELLSRIKHSNVASVLGVCYDISESFLIFKDMCHSSVFSHLFDDDKCSALSWERRVKVATQVARALGYLHTFAEPCVVHRSVSSINVYLDGSWNAKLAGFGSALSVRSRSQE

Gene3D: G3DSA:1.10.510.10
77-134 G3DSA:1.10.510.10

ERRVKVATQVARALGYLHTFAEPCVVHRSVSSINVYLDGSWNAKLAGFGSALSVRSRS

Gene3D: G3DSA:1.10.510.10
141-230 G3DSA:1.10.510.10

AEDVYRVGVFILELLMGQSALNAEEDQPTVVARWAVHVIDTGSGYEILDRRLEVPCERERSARALLKMAEIGAWCMKDKPEDRPNMMEVA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox