PRGDB00182510 (85275)

From PRG Wiki
Jump to: navigation, search
85275
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

DNA Sequence

ATGCTCGTCGCGGCAGTGATTGAGCTCCTCGTCCTCTGGGCGGTTCTTGGGCGAGCGGCATTGCCAGGATCCCAGACCCAGAGCTTGCTGCGCCTCCAGAAGCTCCTGGGGGATCCATCGGCGCTGGGCGGGTGGAGCGTCAACACGTCGTTTTGCTCGCTGCCGTCATCGCCGATGCTCAACGTCTCGTGCGCCTACGCGGATCAGTCGGGCACCCAGACCGTGATCTTGCTCCAGATTGTGGGTGACAAGCTTCCAATCACGGTCCGCCTCCCGGACGACTTCTCGATCATCACTCTGGCCAACACGCTCGTCAAGTTCCCCGACCTCCGCACGCTCACGCTCGTCTCCCTCGGCATCTGGGGCCTCGTCCCCGCCAGCCTCGACCACCTCCGCTCGCTCGAGCTCCTCAACCTCAGCTCCAACTTCCTCTCCGGCTCCATCCCCGACCGCTTCTCCTCCCTCGGCAGCCTCCAGTCGCTCGCCCTCGACAACAACATCCTCCGCGGGACCTTCCCCACCGCGCTCAATGTCCTCCCCAACCTCGACACCCTCCAGCTCTCGCACAACCAGATCGCCGGCACCATCCCTTCGCAAATCTCCCTCTTCGCCAGCCTCAAGACGCTCGACATGGACCACAACTTGCTCTTCGGCGCGCTCCCGGACTCCATCTCCAACATGAGGGTGGCGGAGACCATCTCCATCTCGGACAACTTTTTGGCCGGCGTGGTACCAAACTTGAGCCGGGTGGCGAGCCTGCGCACTCTCAACTTGGCCGGGAACCAGCTCGGCCCCTCCTTCCCGGGCCTCGGCCAGGGCCTCGTCTCCGCCAACCTCGAGAGGAACCGCTTCTCCGACTCCATCCCGGACAGCCTGCGCGGCCTCTCCCAGCTCAAGCTCCTCAACCTCTCGCTCAACTCCATCCCGGGGGCGCTGCCGGGATGGATCTTCTCGCTGCAAAGTTTGGAGACGCTGGTGCTGGATCACAACCGGCTGTCCGGGACTCTTCCCAGTGCTGTGACGCTGGCGAGCGGGCTGCGATACGTGGACATCTCCACGAATCTTTTGATGGGGGAGGTCCCCGCGGAGCTGCGGTCCGGGAGGATCACGTTGCATGTCGAGGAGAACTGCTTCTCCGGGCAGGAGATCCAGCTCCAGCAGCAGCAGCCGCAAGAGTATTGTCTCAAGGCGCAGAGGATGATACCGCGGCGGTGGAAAGGTGGCGTTGTAGCTGGGATCGCCGGCGGAGTCATGGCCGTGGGTGCTGCCATGGCTTTACTGCTGGTGATACTCCTGCGCTTCTCCAAGAGAGGGAAGCTCAAGCTCAAGCATGCGGCTGCTACTTGTGCGAACAACTCGTGTGCTGATACGGCCTCGGTGGGAGTTCCCTTGGAGCTCCTCCATAGCACGAGATACTTGGCTCAATCCGGGACTGTCGGAGCAACCGGACCAAACCAGTGTCGGGTTTTCTCGCTGCTGGAGCTGGAAGAGGCCACGAGTCGATTCAGCCAAGGTTTACTCATTGGAGAGGGCGAGTATGGAAAGGTGTTCAGAGGAAAGCTTGACGATGGAACGCTGGTCGCGATCAAATGCCTGGTTATCGATTCGAGGCAGGAGATGAAGCAGCTCAAGGCACATTTGGAGTTCCTGTCGAGGATCCGACACAGGCACTTGGTCAGTCTCTTTGGCTACTGCCTCGAGCGAGAGAAGGATGGACCCCAGCACCGGCGGCTCTACCTCGTCTCCGAGTTCATCGATAATGGCACTCTTCGCAGCCATCTCTTCAAGCGAAAATTGAAGGAGTCTTTAACGTGGCAAAACCGGCTGGTCGCGGCTCTCGGCGCCGGCCGGGGGATACACTACCTTCACACGGGCGTCGTGCCGGGGATTTTCAACAACGACGTGAGGGTCACGAACGTTTTGCTGGATCACAATTTTGTAGGAAAAGTGAGCGATTTTGGATTAGCCAGGCATCCCGAGAGCGAGTCGTACCATTTCCATTCTTTTCTTCTCTCTCACTCTTTCTTTTCTTTTTTTCTTTCCAGGAAGCTGGCCACGGACAAGAGAGATGTGTATAACTTTGGACTTATATTACTCGAGATTGTTCTCGGGAGACCACCAACCGTAGACAATCCCATGGCCATGAAACCCAAAGTCCAAGAGCTCGTAAGTTCCTCCTCCTCTGTGTTTCGGACGGAGATGGTGGACTCGGCGATCTCGGGAACTTGTTCCGAGGATTCTCTGTCGACGGTGTTGGAGATTGCTGCAAAGTGCCTGTCGAGTGACCTCACCGCCAGGCCCTCGATGGAAGACGTCCTGTGGAACCTCCAATATGCAGTCCAAGTCCAAGACCAAAGATTTAGTGGAGAGTACCTCGAAGACTCCAGTGGAAGAGAATAA


Protein sequences

Name Description Sequence
85275 Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

MLVAAVIELLVLWAVLGRAALPGSQTQSLLRLQKLLGDPSALGGWSVNTSFCSLPSSPMLNVSCAYADQSGTQTVILLQIVGDKLPITVRLPDDFSIITLANTLVKFPDLRTLTLVSLGIWGLVPASLDHLRSLELLNLSSNFLSGSIPDRFSSLGSLQSLALDNNILRGTFPTALNVLPNLDTLQLSHNQIAGTIPSQISLFASLKTLDMDHNLLFGALPDSISNMRVAETISISDNFLAGVVPNLSRVASLRTLNLAGNQLGPSFPGLGQGLVSANLERNRFSDSIPDSLRGLSQLKLLNLSLNSIPGALPGWIFSLQSLETLVLDHNRLSGTLPSAVTLASGLRYVDISTNLLMGEVPAELRSGRITLHVEENCFSGQEIQLQQQQPQEYCLKAQRMIPRRWKGGVVAGIAGGVMAVGAAMALLLVILLRFSKRGKLKLKHAAATCANNSCADTASVGVPLELLHSTRYLAQSGTVGATGPNQCRVFSLLELEEATSRFSQGLLIGEGEYGKVFRGKLDDGTLVAIKCLVIDSRQEMKQLKAHLEFLSRIRHRHLVSLFGYCLEREKDGPQHRRLYLVSEFIDNGTLRSHLFKRKLKESLTWQNRLVAALGAGRGIHYLHTGVVPGIFNNDVRVTNVLLDHNFVGKVSDFGLARHPESESYHFHSFLLSHSFFSFFLSRKLATDKRDVYNFGLILLEIVLGRPPTVDNPMAMKPKVQELVSSSSSVFRTEMVDSAISGTCSEDSLSTVLEIAAKCLSSDLTARPSMEDVLWNLQYAVQVQDQRFSGEYLEDSSGRE*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF465
1-784 PTHR24420:SF465,SUBFAMILY NOT NAMED

MLVAAVIELLVLWAVLGRAALPGSQTQSLLRLQKLLGDPSALGGWSVNTSFCSLPSSPMLNVSCAYADQSGTQTVILLQIVGDKLPITVRLPDDFSIITLANTLVKFPDLRTLTLVSLGIWGLVPASLDHLRSLELLNLSSNFLSGSIPDRFSSLGSLQSLALDNNILRGTFPTALNVLPNLDTLQLSHNQIAGTIPSQISLFASLKTLDMDHNLLFGALPDSISNMRVAETISISDNFLAGVVPNLSRVASLRTLNLAGNQLGPSFPGLGQGLVSANLERNRFSDSIPDSLRGLSQLKLLNLSLNSIPGALPGWIFSLQSLETLVLDHNRLSGTLPSAVTLASGLRYVDISTNLLMGEVPAELRSGRITLHVEENCFSGQEIQLQQQQPQEYCLKAQRMIPRRWKGGVVAGIAGGVMAVGAAMALLLVILLRFSKRGKLKLKHAAATCANNSCADTASVGVPLELLHSTRYLAQSGTVGATGPNQCRVFSLLELEEATSRFSQGLLIGEGEYGKVFRGKLDDGTLVAIKCLVIDSRQEMKQLKAHLEFLSRIRHRHLVSLFGYCLEREKDGPQHRRLYLVSEFIDNGTLRSHLFKRKLKESLTWQNRLVAALGAGRGIHYLHTGVVPGIFNNDVRVTNVLLDHNFVGKVSDFGLARHPESESYHFHSFLLSHSFFSFFLSRKLATDKRDVYNFGLILLEIVLGRPPTVDNPMAMKPKVQELVSSSSSVFRTEMVDSAISGTCSEDSLSTVLEIAAKCLSSDLTARPSMEDVLWNLQYAVQVQD

HMMPanther: PTHR24420
1-784 PTHR24420,FAMILY NOT NAMED

MLVAAVIELLVLWAVLGRAALPGSQTQSLLRLQKLLGDPSALGGWSVNTSFCSLPSSPMLNVSCAYADQSGTQTVILLQIVGDKLPITVRLPDDFSIITLANTLVKFPDLRTLTLVSLGIWGLVPASLDHLRSLELLNLSSNFLSGSIPDRFSSLGSLQSLALDNNILRGTFPTALNVLPNLDTLQLSHNQIAGTIPSQISLFASLKTLDMDHNLLFGALPDSISNMRVAETISISDNFLAGVVPNLSRVASLRTLNLAGNQLGPSFPGLGQGLVSANLERNRFSDSIPDSLRGLSQLKLLNLSLNSIPGALPGWIFSLQSLETLVLDHNRLSGTLPSAVTLASGLRYVDISTNLLMGEVPAELRSGRITLHVEENCFSGQEIQLQQQQPQEYCLKAQRMIPRRWKGGVVAGIAGGVMAVGAAMALLLVILLRFSKRGKLKLKHAAATCANNSCADTASVGVPLELLHSTRYLAQSGTVGATGPNQCRVFSLLELEEATSRFSQGLLIGEGEYGKVFRGKLDDGTLVAIKCLVIDSRQEMKQLKAHLEFLSRIRHRHLVSLFGYCLEREKDGPQHRRLYLVSEFIDNGTLRSHLFKRKLKESLTWQNRLVAALGAGRGIHYLHTGVVPGIFNNDVRVTNVLLDHNFVGKVSDFGLARHPESESYHFHSFLLSHSFFSFFLSRKLATDKRDVYNFGLILLEIVLGRPPTVDNPMAMKPKVQELVSSSSSVFRTEMVDSAISGTCSEDSLSTVLEIAAKCLSSDLTARPSMEDVLWNLQYAVQVQD

superfamily: SSF52058
19-366 SSF52058,LRR

AALPGSQTQSLLRLQKLLGDPSALGGWSVNTSFCSLPSSPMLNVSCAYADQSGTQTVILLQIVGDKLPITVRLPDDFSIITLANTLVKFPDLRTLTLVSLGIWGLVPASLDHLRSLELLNLSSNFLSGSIPDRFSSLGSLQSLALDNNILRGTFPTALNVLPNLDTLQLSHNQIAGTIPSQISLFASLKTLDMDHNLLFGALPDSISNMRVAETISISDNFLAGVVPNLSRVASLRTLNLAGNQLGPSFPGLGQGLVSANLERNRFSDSIPDSLRGLSQLKLLNLSLNSIPGALPGWIFSLQSLETLVLDHNRLSGTLPSAVTLASGLRYVDISTNLLMGEVPAELRS

Gene3D: G3DSA:3.80.10.10
104-265 G3DSA:3.80.10.10

LVKFPDLRTLTLVSLGIWGLVPASLDHLRSLELLNLSSNFLSGSIPDRFSSLGSLQSLALDNNILRGTFPTALNVLPNLDTLQLSHNQIAGTIPSQISLFASLKTLDMDHNLLFGALPDSISNMRVAETISISDNFLAGVVPNLSRVASLRTLNLAGNQLGP

HMMPfam: PF00560
IPR001611
133-155 LRR_1
Leucine-rich repeat

SLELLNLSSNFLSGSIPDRFSSL

ProfileScan: PS51450
IPR001611
133-155 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLELLNLSSNFLSGSIPDRFSSL

ProfileScan: PS51450
IPR001611
157-180 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQSLALDNNILRGTFPTALNVLP

ProfileScan: PS51450
IPR001611
181-203 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLDTLQLSHNQIAGTIPSQISLF

ProfileScan: PS51450
IPR001611
205-227 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKTLDMDHNLLFGALPDSISNM

ProfileScan: PS51450
IPR001611
252-274 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRTLNLAGNQLGPSFPGLGQGL

Gene3D: G3DSA:3.80.10.10
272-381 G3DSA:3.80.10.10

QGLVSANLERNRFSDSIPDSLRGLSQLKLLNLSLNSIPGALPGWIFSLQSLETLVLDHNRLSGTLPSAVTLASGLRYVDISTNLLMGEVPAELRSGRITLHVEENCFSGQ

HMMPfam: PF13855
278-332 LRR_8,Leucine rich repeat

NLERNRFSDSIPDSLRGLSQLKLLNLSLNSIPGALPGWIFSLQSLETLVLDHNRL

ProfileScan: PS51450
IPR001611
297-319 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKLLNLSLNSIPGALPGWIFSL

ProfileScan: PS51450
IPR001611
321-343 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLETLVLDHNRLSGTLPSAVTLA

superfamily: SSF56112
IPR011009
472-784 Kinase_like
Protein kinase-like domain

YLAQSGTVGATGPNQCRVFSLLELEEATSRFSQGLLIGEGEYGKVFRGKLDDGTLVAIKCLVIDSRQEMKQLKAHLEFLSRIRHRHLVSLFGYCLEREKDGPQHRRLYLVSEFIDNGTLRSHLFKRKLKESLTWQNRLVAALGAGRGIHYLHTGVVPGIFNNDVRVTNVLLDHNFVGKVSDFGLARHPESESYHFHSFLLSHSFFSFFLSRKLATDKRDVYNFGLILLEIVLGRPPTVDNPMAMKPKVQELVSSSSSVFRTEMVDSAISGTCSEDSLSTVLEIAAKCLSSDLTARPSMEDVLWNLQYAVQVQD

Gene3D: G3DSA:3.30.200.20
484-584 G3DSA:3.30.200.20

PNQCRVFSLLELEEATSRFSQGLLIGEGEYGKVFRGKLDDGTLVAIKCLVIDSRQEMKQLKAHLEFLSRIRHRHLVSLFGYCLEREKDGPQHRRLYLVSEF

ProfileScan: PS50011
IPR000719
502-779 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSQGLLIGEGEYGKVFRGKLDDGTLVAIKCLVIDSRQEMKQLKAHLEFLSRIRHRHLVSLFGYCLEREKDGPQHRRLYLVSEFIDNGTLRSHLFKRKLKESLTWQNRLVAALGAGRGIHYLHTGVVPGIFNNDVRVTNVLLDHNFVGKVSDFGLARHPESESYHFHSFLLSHSFFSFFLSRKLATDKRDVYNFGLILLEIVLGRPPTVDNPMAMKPKVQELVSSSSSVFRTEMVDSAISGTCSEDSLSTVLEIAAKCLSSDLTARPSMEDVLWNLQYA

HMMPfam: PF07714
IPR001245
507-774 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

LIGEGEYGKVFRGKLDDGTLVAIKCLVIDSRQEMKQLKAHLEFLSRIRHRHLVSLFGYCLEREKDGPQHRRLYLVSEFIDNGTLRSHLFKRKLKESLTWQNRLVAALGAGRGIHYLHTGVVPGIFNNDVRVTNVLLDHNFVGKVSDFGLARHPESESYHFHSFLLSHSFFSFFLSRKLATDKRDVYNFGLILLEIVLGRPPTVDNPMAMKPKVQELVSSSSSVFRTEMVDSAISGTCSEDSLSTVLEIAAKCLSSDLTARPSMEDVLW

PatternScan: PS00107
IPR017441
508-530 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGEYGKVFRGKLDDGTLVAIK

Gene3D: G3DSA:1.10.510.10
585-780 G3DSA:1.10.510.10

IDNGTLRSHLFKRKLKESLTWQNRLVAALGAGRGIHYLHTGVVPGIFNNDVRVTNVLLDHNFVGKVSDFGLARHPESESYHFHSFLLSHSFFSFFLSRKLATDKRDVYNFGLILLEIVLGRPPTVDNPMAMKPKVQELVSSSSSVFRTEMVDSAISGTCSEDSLSTVLEIAAKCLSSDLTARPSMEDVLWNLQYAV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox