PRGDB00182511 (114392)

From PRG Wiki
Jump to: navigation, search
114392
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Leucine-rich repeat transmembrane protein kinase (best arabidopsis hit)

DNA Sequence

ATGATCGCGAATTTCATCGCCATTCTTGTCACTGGGCTGTGGATTTCGACGAGCAGCGGGGCGAGCGTGAATCCTCTCCTGGATTTCCGAAGTGGGCTCACCAATTCCCAGGCTCTGGGCGACTGGATCATCGGTTCGTCGCCATGCGGCGCCAAGAAATGGACAGGGATCTCGTGCGCGTCCACGGGGGCAATCGTGGCCATCTCGCTCAGCGGCCTGGAGCTGCAAGGCCCAATCTCCGCCGCCACCGCGCTGCTAGGGCTCCCGGTACTCGAGGAGCTCGATCTCAGCAACAACGCCCTCTCGGGCGAGATCCCTCCACAGCTCTGGCAGCTGCCCAAGATCAAGCGCCTGGATCTAAGCCACAATCTCCTCCAAGGCGCCAGCTTTGATCGCCTCTTCGGCCACATCCCTCCATCGATCTTCTCCCTAGCGGCGCTGCGGCAGCTGGATTTGAGCAGCAATCTCTTGTCCGGCACCATCCCAGCGTCCAATCTCTCGCGCTCGCTCCAGATCCTCGACCTCGCCAACAATTCCCTCACTGGCGAGATCCCGCCCAGCATCGGTGATCTCTCCAACCTCACCGAGCTCTCTCTCGGCCTCAACTCTGCGCTGCTCGGTTCCATCCCGCCCTCCATCGGGAAACTCTCCAAGCTCGAGATCCTCTACGCCGCCAACTGCAAGCTCACAGGTCCCATCCCTCGTTCCCTCCCGCCATCGCTCCGCAAGCTCGATCTCTCCAACAATCCCCTCCAATCGCCCATCCCGGATTCCATCGGTGATCTCTCCCGGATCCAATCCATCAGCATTGCGTCCGCGCAGCTCAATGGATCCATCCCGGCGTCGCTCGGGCGGTGCTCCAGCCTCGAGCTCCTCAATCTGGCCTTCAATCAGCTCTCCGGGCCTCTCCCTGACGATCTCGCGGCGCTGGAAAAGATCATCACGTTCTCGGTGGTGGGGAATTCGCTCTCGGGACCAATCCCGCGCTGGATCGGGCAGTGGCAGCTCGCGGACTCCATACTGCTCTCCACGAACTCGTTCTCGGGCAGTATACCGCCGGAGCTCGGGCAGTGCCGTGCGGTAACAGACCTGGGCCTGGATAACAACCAGCTCACCGGCAGCATACCGCCCGAGCTGTGCGACGCAGGTCTCCTCTCTCAGTTGACCCTTGACCACAACACGTTGACCGGGTCCCTGGCAGGCGGTACGCTGCGGCGGTGCGGCAATCTCACGCAGCTCGACGTCACCGGCAACCGGCTCACGGGTGAAATCCCGCGGTACTTCTCGGATCTCCCCAAGCTCGTGATCTTGGACATCAGCACGAATTTCTTCGTGGGATCCATCCCCGACGAGCTGTGGCACGCGACGCAGCTCATGGAGATCTACGCGAGCGACAATCTTCTCGAGGGCGGGCTGAGCCCGCTGGTGGGAGGGATGGAGAATTTGCAGCACTTGTACCTGGATCGCAACCGGCTCAGCGGTCCGCTGCCCAGCGAGCTCGGACTTCTCAAGAGCTTGACGGTGCTCTCTCTGGCTGGGAATGCATTCGATGGGGTGATTCCACGAGAGATCTTTGGTGGTACCACTGGGTTGACGACGCTGGATCTCGGTGGCAATCGCCTTGGCGGTGCCATACCGCCCGAGATCGGTAAGCTGGTCGGGCTGGATTGCCTGGTTCTCTCACACAACCGGCTCTCGGGGCAAATTCCAGCCGAGGTGGCGAGCTTGTTTCAGATCGCAGTGCCGCCCGAGTCGGGCTTCGTCCAGCATCACGGGGTTTTGGATCTGTCACACAACTCGCTCACGGGTCCCATTCCTTCCGGGATCGGCCAGTGCTCGGTGCTCGTGGAGCTCGATCTCTCCAACAATTTGCTCCAGGGGAGGATACCGCCCGAGATATCTTTGCTCGCCAACCTCACCACCTTGGATCTTTCGAGCAACATGCTCCAGGGGAGGATTCCCTGGCAGCTCGGAGAGAACTCCAAGCTCCAGGGGCTCAACCTCGGGTTTAACAGGTTGACGGGGCAAATACCACCCGAGCTGGGCAACTTGGAGAGGCTGGTCAAGCTCAACATCTCGGGCAATGCTCTCACGGGATCCATCCCGGATCATCTCGGGCAGCTCTTAGGATTGAGTCACCTCGACGCCAGTGGCAATGGGCTCACTGGATCGCTCCCGGATTCCTTCTCCGGATTGGTTTCCATCGTGGGCCTCAAGAACTCGTTGACTGGCGAGATTCCAAGCGAGATTGGAGGCATCTTGCAGCTGAGCTACCTGGATCTGTCTGTGAACAAGCTCGTCGGGGGTATACCGGGTAGTCTCTGCGAGTTGACCGAGCTCGGCTTCTTCAACGTCTCGGACAATGGGTTGACGGGTGATATACCCCAGGAGGGCATATGCAAGAACTTCTCGCGGCTCTCGTATGGTGGCAATCTAGGGCTGTGTGGATTGGCGGTGGGAGTGAGCTGTGGAGCGCTTGATGATCTTCGCGGCAATGGCGGCCAGCCCGTGCTTCTCAAACCGGGTGCCATTTGGGCGATCACCATGGCCAGCACGGTTGCGTTTTTTTGCATCGTGTTTGTGGCGATCCGGTGGAGGATGATGCGGCAGCAGTCGGAAGCGCTGCTGGGCGAGAAGATCAAGCTCAACAGCGGCAACCACAACAACAACAACAGCCATGGATCGACCTCGGACGGCACTAACACCGATGTGTCCCGGGAGCCACTGAGCATCAACGTCGCCATGTTTGAGAGACCGCTGCTCAAGCTCACGCTGTCCGACATCGTGACCGCGACCAACGGCTTCTCAAAGGCCAACGTGATCGGGGACGGCGGGTACGGCACGGTGTACCGCGCGGTACTGCCCGACGGCCGCACGGTGGCGGTCAAGAAGCTGGCGCCGGTCCGGGACTACCGCGCGGTAAGCAGCGGTAGCAGCTGCCGCGAGTTCCTGGCCGAGATGGAGACGCTGGGTAAGGTAAAGCACCGTAACTTGGTAACTCTGCTGGGTTACTGCTCGTACGGCGAGGAGCGGCTGCTGGTGTACGACTACATGGTCAACGGGAGCCTTGACGTGTGGCTCCGGAATCGAACCGACGCGCTGGAGGCCCTGACGTGGGACCGCCGGCTGCGCATCGCGGTGGGCGCGGCGCGTGGCCTGGCGTTTCTCCACCATGGGATCGTGCCACATGTCATCCATCGCGATGTCAAGGCGAGCAACATTCTCCTGGACGCCGACTTCGAGCCACGTGTCGCGGACTTTGGGCTGGCGCGGCTGATCTCGGCGTACGACACGCACGTCAGCACGGACATCGCCGGGACTTTCGGGTATATCCCGCCCGAGTACGGTATGACGTGGCGTGCTACGTCAAAGGGTGACGTCTACAGCTATGGCGTCATCTTGCTGGAGCTGGTGACGGGGAAGGAGCCGACTGGGCCGGACTTCAAGGACACTGAGATTGGTAACTTGGTGGGCTGGGTGAGGTCCATGGTACGGCAGGGTAAAAGTGACGAGGTACTCGACGTGGCGGTGGCTACGCGAGCCACGTGGAGGTCCTGCATGCACCAGGTCCTCCACATTGCGATGGTGTGTACGGCGGATGAGCCCATGAAGCGCCCGCCCATGATGGAAGTTGTACGTCAGCTCAAGGAGTTAGAGCTATAG


Protein sequences

Name Description Sequence
114392 Leucine-rich repeat transmembrane protein kinase (best arabidopsis hit)

MIANFIAILVTGLWISTSSGASVNPLLDFRSGLTNSQALGDWIIGSSPCGAKKWTGISCASTGAIVAISLSGLELQGPISAATALLGLPVLEELDLSNNALSGEIPPQLWQLPKIKRLDLSHNLLQGASFDRLFGHIPPSIFSLAALRQLDLSSNLLSGTIPASNLSRSLQILDLANNSLTGEIPPSIGDLSNLTELSLGLNSALLGSIPPSIGKLSKLEILYAANCKLTGPIPRSLPPSLRKLDLSNNPLQSPIPDSIGDLSRIQSISIASAQLNGSIPASLGRCSSLELLNLAFNQLSGPLPDDLAALEKIITFSVVGNSLSGPIPRWIGQWQLADSILLSTNSFSGSIPPELGQCRAVTDLGLDNNQLTGSIPPELCDAGLLSQLTLDHNTLTGSLAGGTLRRCGNLTQLDVTGNRLTGEIPRYFSDLPKLVILDISTNFFVGSIPDELWHATQLMEIYASDNLLEGGLSPLVGGMENLQHLYLDRNRLSGPLPSELGLLKSLTVLSLAGNAFDGVIPREIFGGTTGLTTLDLGGNRLGGAIPPEIGKLVGLDCLVLSHNRLSGQIPAEVASLFQIAVPPESGFVQHHGVLDLSHNSLTGPIPSGIGQCSVLVELDLSNNLLQGRIPPEISLLANLTTLDLSSNMLQGRIPWQLGENSKLQGLNLGFNRLTGQIPPELGNLERLVKLNISGNALTGSIPDHLGQLLGLSHLDASGNGLTGSLPDSFSGLVSIVGLKNSLTGEIPSEIGGILQLSYLDLSVNKLVGGIPGSLCELTELGFFNVSDNGLTGDIPQEGICKNFSRLSYGGNLGLCGLAVGVSCGALDDLRGNGGQPVLLKPGAIWAITMASTVAFFCIVFVAIRWRMMRQQSEALLGEKIKLNSGNHNNNNSHGSTSDGTNTDVSREPLSINVAMFERPLLKLTLSDIVTATNGFSKANVIGDGGYGTVYRAVLPDGRTVAVKKLAPVRDYRAVSSGSSCREFLAEMETLGKVKHRNLVTLLGYCSYGEERLLVYDYMVNGSLDVWLRNRTDALEALTWDRRLRIAVGAARGLAFLHHGIVPHVIHRDVKASNILLDADFEPRVADFGLARLISAYDTHVSTDIAGTFGYIPPEYGMTWRATSKGDVYSYGVILLELVTGKEPTGPDFKDTEIGNLVGWVRSMVRQGKSDEVLDVAVATRATWRSCMHQVLHIAMVCTADEPMKRPPMMEVVRQLKELEL*

Domains

Domain Start-End Description Sequence

superfamily: SSF52058
16-333 SSF52058,LRR

STSSGASVNPLLDFRSGLTNSQALGDWIIGSSPCGAKKWTGISCASTGAIVAISLSGLELQGPISAATALLGLPVLEELDLSNNALSGEIPPQLWQLPKIKRLDLSHNLLQGASFDRLFGHIPPSIFSLAALRQLDLSSNLLSGTIPASNLSRSLQILDLANNSLTGEIPPSIGDLSNLTELSLGLNSALLGSIPPSIGKLSKLEILYAANCKLTGPIPRSLPPSLRKLDLSNNPLQSPIPDSIGDLSRIQSISIASAQLNGSIPASLGRCSSLELLNLAFNQLSGPLPDDLAALEKIITFSVVGNSLSGPIPRWIGQ

HMMPanther: PTHR24420
26-1219 PTHR24420,FAMILY NOT NAMED

LLDFRSGLTNSQALGDWIIGSSPCGAKKWTGISCASTGAIVAISLSGLELQGPISAATALLGLPVLEELDLSNNALSGEIPPQLWQLPKIKRLDLSHNLLQGASFDRLFGHIPPSIFSLAALRQLDLSSNLLSGTIPASNLSRSLQILDLANNSLTGEIPPSIGDLSNLTELSLGLNSALLGSIPPSIGKLSKLEILYAANCKLTGPIPRSLPPSLRKLDLSNNPLQSPIPDSIGDLSRIQSISIASAQLNGSIPASLGRCSSLELLNLAFNQLSGPLPDDLAALEKIITFSVVGNSLSGPIPRWIGQWQLADSILLSTNSFSGSIPPELGQCRAVTDLGLDNNQLTGSIPPELCDAGLLSQLTLDHNTLTGSLAGGTLRRCGNLTQLDVTGNRLTGEIPRYFSDLPKLVILDISTNFFVGSIPDELWHATQLMEIYASDNLLEGGLSPLVGGMENLQHLYLDRNRLSGPLPSELGLLKSLTVLSLAGNAFDGVIPREIFGGTTGLTTLDLGGNRLGGAIPPEIGKLVGLDCLVLSHNRLSGQIPAEVASLFQIAVPPESGFVQHHGVLDLSHNSLTGPIPSGIGQCSVLVELDLSNNLLQGRIPPEISLLANLTTLDLSSNMLQGRIPWQLGENSKLQGLNLGFNRLTGQIPPELGNLERLVKLNISGNALTGSIPDHLGQLLGLSHLDASGNGLTGSLPDSFSGLVSIVGLKNSLTGEIPSEIGGILQLSYLDLSVNKLVGGIPGSLCELTELGFFNVSDNGLTGDIPQEGICKNFSRLSYGGNLGLCGLAVGVSCGALDDLRGNGGQPVLLKPGAIWAITMASTVAFFCIVFVAIRWRMMRQQSEALLGEKIKLNSGNHNNNNSHGSTSDGTNTDVSREPLSINVAMFERPLLKLTLSDIVTATNGFSKANVIGDGGYGTVYRAVLPDGRTVAVKKLAPVRDYRAVSSGSSCREFLAEMETLGKVKHRNLVTLLGYCSYGEERLLVYDYMVNGSLDVWLRNRTDALEALTWDRRLRIAVGAARGLAFLHHGIVPHVIHRDVKASNILLDADFEPRVADFGLARLISAYDTHVSTDIAGTFGYIPPEYGMTWRATSKGDVYSYGVILLELVTGKEPTGPDFKDTEIGNLVGWVRSMVRQGKSDEVLDVAVATRATWRSCMHQVLHIAMVCTADEPMKRPPMMEVVRQLKELE

HMMPfam: PF08263
IPR013210
26-59 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

LLDFRSGLTNSQALGDWIIGSSPCGAKKWTGISC

Gene3D: G3DSA:3.80.10.10
68-150 G3DSA:3.80.10.10

ISLSGLELQGPISAATALLGLPVLEELDLSNNALSGEIPPQLWQLPKIKRLDLSHNLLQGASFDRLFGHIPPSIFSLAALRQL

ProfileScan: PS51450
IPR001611
90-113 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLEELDLSNNALSGEIPPQLWQLP

HMMPfam: PF12799
90-126 LRR_4,Leucine Rich repeats (2 copies)

VLEELDLSNNALSGEIPPQLWQLPKIKRLDLSHNLLQ

FPrintScan: PR00019
91-104 LEURICHRPT,Leucine-rich repeat signature

LEELDLSNNALSGE

ProfileScan: PS51450
IPR001611
114-134 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KIKRLDLSHNLLQGASFDRLF

ProfileScan: PS51450
IPR001611
146-167 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALRQLDLSSNLLSGTIPASNLS

Gene3D: G3DSA:3.80.10.10
151-245 G3DSA:3.80.10.10

DLSSNLLSGTIPASNLSRSLQILDLANNSLTGEIPPSIGDLSNLTELSLGLNSALLGSIPPSIGKLSKLEILYAANCKLTGPIPRSLPPSLRKLD

ProfileScan: PS51450
IPR001611
169-191 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLQILDLANNSLTGEIPPSIGDL

HMMPfam: PF00560
IPR001611
169-190 LRR_1
Leucine-rich repeat

SLQILDLANNSLTGEIPPSIGD

ProfileScan: PS51450
IPR001611
193-216 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTELSLGLNSALLGSIPPSIGKL

ProfileScan: PS51450
IPR001611
240-262 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRKLDLSNNPLQSPIPDSIGDL

HMMPfam: PF00560
IPR001611
240-261 LRR_1
Leucine-rich repeat

SLRKLDLSNNPLQSPIPDSIGD

Gene3D: G3DSA:3.80.10.10
246-420 G3DSA:3.80.10.10

LSNNPLQSPIPDSIGDLSRIQSISIASAQLNGSIPASLGRCSSLELLNLAFNQLSGPLPDDLAALEKIITFSVVGNSLSGPIPRWIGQWQLADSILLSTNSFSGSIPPELGQCRAVTDLGLDNNQLTGSIPPELCDAGLLSQLTLDHNTLTGSLAGGTLRRCGNLTQLDVTGNRL

ProfileScan: PS51450
IPR001611
288-311 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLELLNLAFNQLSGPLPDDLAALE

superfamily: SSF52058
339-576 SSF52058,LRR

SILLSTNSFSGSIPPELGQCRAVTDLGLDNNQLTGSIPPELCDAGLLSQLTLDHNTLTGSLAGGTLRRCGNLTQLDVTGNRLTGEIPRYFSDLPKLVILDISTNFFVGSIPDELWHATQLMEIYASDNLLEGGLSPLVGGMENLQHLYLDRNRLSGPLPSELGLLKSLTVLSLAGNAFDGVIPREIFGGTTGLTTLDLGGNRLGGAIPPEIGKLVGLDCLVLSHNRLSGQIPAEVASL

HMMPfam: PF13855
385-442 LRR_8,Leucine rich repeat

LSQLTLDHNTLTGSLAGGTLRRCGNLTQLDVTGNRLTGEIPRYFSDLPKLVILDISTN

ProfileScan: PS51450
IPR001611
409-431 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTQLDVTGNRLTGEIPRYFSDL

Gene3D: G3DSA:3.80.10.10
421-575 G3DSA:3.80.10.10

TGEIPRYFSDLPKLVILDISTNFFVGSIPDELWHATQLMEIYASDNLLEGGLSPLVGGMENLQHLYLDRNRLSGPLPSELGLLKSLTVLSLAGNAFDGVIPREIFGGTTGLTTLDLGGNRLGGAIPPEIGKLVGLDCLVLSHNRLSGQIPAEVAS

ProfileScan: PS51450
IPR001611
481-503 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQHLYLDRNRLSGPLPSELGLL

HMMPfam: PF00560
IPR001611
481-501 LRR_1
Leucine-rich repeat

NLQHLYLDRNRLSGPLPSELG

HMMPfam: PF13855
505-565 LRR_8,Leucine rich repeat

SLTVLSLAGNAFDGVIPREIFGGTTGLTTLDLGGNRLGGAIPPEIGKLVGLDCLVLSHNRL

ProfileScan: PS51450
IPR001611
530-552 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLTTLDLGGNRLGGAIPPEIGKL

ProfileScan: PS51450
IPR001611
554-576 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLDCLVLSHNRLSGQIPAEVASL

superfamily: SSF52058
593-823 SSF52058,LRR

VLDLSHNSLTGPIPSGIGQCSVLVELDLSNNLLQGRIPPEISLLANLTTLDLSSNMLQGRIPWQLGENSKLQGLNLGFNRLTGQIPPELGNLERLVKLNISGNALTGSIPDHLGQLLGLSHLDASGNGLTGSLPDSFSGLVSIVGLKNSLTGEIPSEIGGILQLSYLDLSVNKLVGGIPGSLCELTELGFFNVSDNGLTGDIPQEGICKNFSRLSYGGNLGLCGLAVGVSC

Gene3D: G3DSA:3.80.10.10
593-817 G3DSA:3.80.10.10

VLDLSHNSLTGPIPSGIGQCSVLVELDLSNNLLQGRIPPEISLLANLTTLDLSSNMLQGRIPWQLGENSKLQGLNLGFNRLTGQIPPELGNLERLVKLNISGNALTGSIPDHLGQLLGLSHLDASGNGLTGSLPDSFSGLVSIVGLKNSLTGEIPSEIGGILQLSYLDLSVNKLVGGIPGSLCELTELGFFNVSDNGLTGDIPQEGICKNFSRLSYGGNLGLCGL

ProfileScan: PS51450
IPR001611
614-636 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

VLVELDLSNNLLQGRIPPEISLL

HMMPfam: PF00560
IPR001611
615-634 LRR_1
Leucine-rich repeat

LVELDLSNNLLQGRIPPEIS

FPrintScan: PR00019
636-649 LEURICHRPT,Leucine-rich repeat signature

LANLTTLDLSSNML

HMMPfam: PF00560
IPR001611
638-656 LRR_1
Leucine-rich repeat

NLTTLDLSSNMLQGRIPWQ

ProfileScan: PS51450
IPR001611
638-660 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTTLDLSSNMLQGRIPWQLGEN

HMMPfam: PF00560
IPR001611
662-684 LRR_1
Leucine-rich repeat

KLQGLNLGFNRLTGQIPPELGNL

ProfileScan: PS51450
IPR001611
662-684 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLQGLNLGFNRLTGQIPPELGNL

ProfileScan: PS51450
IPR001611
686-708 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLVKLNISGNALTGSIPDHLGQL

HMMPfam: PF00560
IPR001611
687-708 LRR_1
Leucine-rich repeat

LVKLNISGNALTGSIPDHLGQL

ProfileScan: PS51450
IPR001611
710-732 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLSHLDASGNGLTGSLPDSFSGL

HMMPfam: PF00560
IPR001611
711-732 LRR_1
Leucine-rich repeat

LSHLDASGNGLTGSLPDSFSGL

ProfileScan: PS51450
IPR001611
755-777 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLSYLDLSVNKLVGGIPGSLCEL

superfamily: SSF56112
IPR011009
905-1215 Kinase_like
Protein kinase-like domain

SREPLSINVAMFERPLLKLTLSDIVTATNGFSKANVIGDGGYGTVYRAVLPDGRTVAVKKLAPVRDYRAVSSGSSCREFLAEMETLGKVKHRNLVTLLGYCSYGEERLLVYDYMVNGSLDVWLRNRTDALEALTWDRRLRIAVGAARGLAFLHHGIVPHVIHRDVKASNILLDADFEPRVADFGLARLISAYDTHVSTDIAGTFGYIPPEYGMTWRATSKGDVYSYGVILLELVTGKEPTGPDFKDTEIGNLVGWVRSMVRQGKSDEVLDVAVATRATWRSCMHQVLHIAMVCTADEPMKRPPMMEVVRQL

Gene3D: G3DSA:2.60.120.200
IPR013320
910-953 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

SINVAMFERPLLKLTLSDIVTATNGFSKANVIGDGGYGTVYRAV

ProfileScan: PS50011
IPR000719
935-1220 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKANVIGDGGYGTVYRAVLPDGRTVAVKKLAPVRDYRAVSSGSSCREFLAEMETLGKVKHRNLVTLLGYCSYGEERLLVYDYMVNGSLDVWLRNRTDALEALTWDRRLRIAVGAARGLAFLHHGIVPHVIHRDVKASNILLDADFEPRVADFGLARLISAYDTHVSTDIAGTFGYIPPEYGMTWRATSKGDVYSYGVILLELVTGKEPTGPDFKDTEIGNLVGWVRSMVRQGKSDEVLDVAVATRATWRSCMHQVLHIAMVCTADEPMKRPPMMEVVRQLKELEL

HMMPfam: PF07714
IPR001245
938-1215 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

ANVIGDGGYGTVYRAVLPDGRTVAVKKLAPVRDYRAVSSGSSCREFLAEMETLGKVKHRNLVTLLGYCSYGEERLLVYDYMVNGSLDVWLRNRTDALEALTWDRRLRIAVGAARGLAFLHHGIVPHVIHRDVKASNILLDADFEPRVADFGLARLISAYDTHVSTDIAGTFGYIPPEYGMTWRATSKGDVYSYGVILLELVTGKEPTGPDFKDTEIGNLVGWVRSMVRQGKSDEVLDVAVATRATWRSCMHQVLHIAMVCTADEPMKRPPMMEVVRQL

PatternScan: PS00107
IPR017441
941-964 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGDGGYGTVYRAVLPDGRTVAVKK

Gene3D: G3DSA:3.30.200.20
954-1004 G3DSA:3.30.200.20

LPDGRTVAVKKLAPVRDYRAVSSGSSCREFLAEMETLGKVKHRNLVTLLGY

Gene3D: G3DSA:1.10.510.10
1005-1212 G3DSA:1.10.510.10

CSYGEERLLVYDYMVNGSLDVWLRNRTDALEALTWDRRLRIAVGAARGLAFLHHGIVPHVIHRDVKASNILLDADFEPRVADFGLARLISAYDTHVSTDIAGTFGYIPPEYGMTWRATSKGDVYSYGVILLELVTGKEPTGPDFKDTEIGNLVGWVRSMVRQGKSDEVLDVAVATRATWRSCMHQVLHIAMVCTADEPMKRPPMMEVV

PatternScan: PS00108
IPR008271
1064-1076 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox