PRGDB00182513 (61771)

From PRG Wiki
Jump to: navigation, search
61771
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Concanavalin A-like lectin protein kinase family protein (best arabidopsis hit)

DNA Sequence

AGCATCTTCCTCACCTCGGGGCAGCCAGGGAGTGTCGGACGAGTCTACCACAAGCTCCCGGTCCGCTTCCGCCATGCCGACGCCCCTGTCAAGCTCGTCACCTTCAATACCTCGTTTCAGTTCAAGATCACGCAGCCGTCGTGCCAGCAGGGAGAAGGATTCGCCTTCGTCGTCGTCCCCAAGCCTCGGGCTCCTCCACCCGGAAGCGTCCTCGGCCTCATGACCCCCGGCCGGAGCCTCAACCACACGTTTGCGGTGGAGTTTGACACGCACCAGAACATGGTGTACGAGGACCCGCCCTGGCAGCACGTCGGTGTGGATCTCGGCAGCCTCATCTCGGCTCAAACGACTGGAAGCAACATGCAGGAGCTCCTGGCCAGTAATCTCACGCTCACCGCGTGGATCGAGTACTGGGGCCTCTACGACACACTAGAGGTGAGAGTTAGCAACGGGAACAGGAGACCCGCAAAGCCAGACCTGGAATTGCCGAGAGTGAGGCTCCCGGCGATTCTCCAGAGGGAAAGCTACTACGTTGGCTTCTCCGCATCCACTGGCCAGTGTCACCAGTATTACCAGATCTACAAATGGAGCTTCACCACCCGGTACGTGAGCCATCCCCCGAACAAGAGCGCACCACCGGGAGCCTGCAAGGCGTGGTACTGCAGTAGAACGAACTTCATAGTCGCGGTTTTGCTGTCCTCGGCCGGGCTGGGAGTCGCGATGCTGCTGCTGGGAGCTGCGCTGCTACAATTCCAGGCCTTCCTCCGGGTCTACCTCAAGACACGGAGTATCCAGAGACGGAACAAAGCTGGCTGCTCCTTCACGCTCTTCAGCTTCGAGGAGTTGGCGCTGGCGACGAAGAACTTCAGCGACAAGGAGCTGCTCGGCCGCGGAGGGATGGGAAGCGTCTACAAAGGAGTGCTGTCCAGCGACGGCTCGGTCGTGGCGGTGAAGCTGCTGGCCAACGATTCCAAGGAGAGCCACCACCAGTTTATATCGGAGCTGTCCATCATCTCCCGCCTCCAGCACAAGAACTTGGTCTCTCTCCGAGGCTGGTGTCACGAGAAAAGCAAACTCATCCTCGTCTACGAGTTCATGCCCAACGGGAGCCTCGACACCATCCTGTTCGACCACCGGCGCGTTCTCCAGTGGGATCAGCGGTACAACATCGCCCAAGGCATCGCCGAAGCGCTCGCCTTCTTGCACGGAGGATGGGAGCACAAGATCGTCCACCGGGACGTGAAAGCCGCAAACGTTTTGCTGGATGCTGATTTCGTTCCCCGGCTCGGCGACTTCGGCCTGGCTCGATTCATGGACGCCACCACCGAGGACATGACCAAAGTCGGAACCTTGGGATACATCGCTCCCGAGTTGGCGTACACCGGAAGAGCAACCGTAAAGTCGGACGTCTACGGCTTTGGAGTGGTCCTCTTGGAGATCGCAACCGGCCTCCACGCGCTTGACAAGAGCTTCGAAGCCGATGGAATAACTCTGCTCGACTGGGTGTGGAAGGCCAACACCGGAGGAATGCTGCTCGAGGCCGCGGACGTGAAGTTGATCAAGTGCTTCGATGCGTTGCAAATGGAGCGCGTCTTGACCCTCGGACTCTTGTGCTGCCATCCCGATGCGGATAGCAGGCCGACGATGCGAGAGTGTTGCCAGTTTCTGAGTGGAGACGTGCCGGCCCCC


Protein sequences

Name Description Sequence
61771 Concanavalin A-like lectin protein kinase family protein (best arabidopsis hit)

SIFLTSGQPGSVGRVYHKLPVRFRHADAPVKLVTFNTSFQFKITQPSCQQGEGFAFVVVPKPRAPPPGSVLGLMTPGRSLNHTFAVEFDTHQNMVYEDPPWQHVGVDLGSLISAQTTGSNMQELLASNLTLTAWIEYWGLYDTLEVRVSNGNRRPAKPDLELPRVRLPAILQRESYYVGFSASTGQCHQYYQIYKWSFTTRYVSHPPNKSAPPGACKAWYCSRTNFIVAVLLSSAGLGVAMLLLGAALLQFQAFLRVYLKTRSIQRRNKAGCSFTLFSFEELALATKNFSDKELLGRGGMGSVYKGVLSSDGSVVAVKLLANDSKESHHQFISELSIISRLQHKNLVSLRGWCHEKSKLILVYEFMPNGSLDTILFDHRRVLQWDQRYNIAQGIAEALAFLHGGWEHKIVHRDVKAANVLLDADFVPRLGDFGLARFMDATTEDMTKVGTLGYIAPELAYTGRATVKSDVYGFGVVLLEIATGLHALDKSFEADGITLLDWVWKANTGGMLLEAADVKLIKCFDALQMERVLTLGLLCCHPDADSRPTMRECCQFLSGDVPAP

Domains

Domain Start-End Description Sequence

superfamily: SSF49899
IPR008985
2-205 ConA_like_lec_gl
Concanavalin A-like lectin/glucanase

IFLTSGQPGSVGRVYHKLPVRFRHADAPVKLVTFNTSFQFKITQPSCQQGEGFAFVVVPKPRAPPPGSVLGLMTPGRSLNHTFAVEFDTHQNMVYEDPPWQHVGVDLGSLISAQTTGSNMQELLASNLTLTAWIEYWGLYDTLEVRVSNGNRRPAKPDLELPRVRLPAILQRESYYVGFSASTGQCHQYYQIYKWSFTTRYVSH

Gene3D: G3DSA:2.60.120.200
IPR013320
4-208 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

LTSGQPGSVGRVYHKLPVRFRHADAPVKLVTFNTSFQFKITQPSCQQGEGFAFVVVPKPRAPPPGSVLGLMTPGRSLNHTFAVEFDTHQNMVYEDPPWQHVGVDLGSLISAQTTGSNMQELLASNLTLTAWIEYWGLYDTLEVRVSNGNRRPAKPDLELPRVRLPAILQRESYYVGFSASTGQCHQYYQIYKWSFTTRYVSHPPN

HMMPfam: PF00139
IPR001220
4-199 Lectin_legB
Legume lectin domain

LTSGQPGSVGRVYHKLPVRFRHADAPVKLVTFNTSFQFKITQPSCQQGEGFAFVVVPKPRAPPPGSVLGLMTPGRSLNHTFAVEFDTHQNMVYEDPPWQHVGVDLGSLISAQTTGSNMQELLASNLTLTAWIEYWGLYDTLEVRVSNGNRRPAKPDLELPRVRLPAILQRESYYVGFSASTGQCHQYYQIYKWSFT

HMMPanther: PTHR24420
221-563 PTHR24420,FAMILY NOT NAMED

CSRTNFIVAVLLSSAGLGVAMLLLGAALLQFQAFLRVYLKTRSIQRRNKAGCSFTLFSFEELALATKNFSDKELLGRGGMGSVYKGVLSSDGSVVAVKLLANDSKESHHQFISELSIISRLQHKNLVSLRGWCHEKSKLILVYEFMPNGSLDTILFDHRRVLQWDQRYNIAQGIAEALAFLHGGWEHKIVHRDVKAANVLLDADFVPRLGDFGLARFMDATTEDMTKVGTLGYIAPELAYTGRATVKSDVYGFGVVLLEIATGLHALDKSFEADGITLLDWVWKANTGGMLLEAADVKLIKCFDALQMERVLTLGLLCCHPDADSRPTMRECCQFLSGDVPAP

superfamily: SSF56112
IPR011009
261-556 Kinase_like
Protein kinase-like domain

TRSIQRRNKAGCSFTLFSFEELALATKNFSDKELLGRGGMGSVYKGVLSSDGSVVAVKLLANDSKESHHQFISELSIISRLQHKNLVSLRGWCHEKSKLILVYEFMPNGSLDTILFDHRRVLQWDQRYNIAQGIAEALAFLHGGWEHKIVHRDVKAANVLLDADFVPRLGDFGLARFMDATTEDMTKVGTLGYIAPELAYTGRATVKSDVYGFGVVLLEIATGLHALDKSFEADGITLLDWVWKANTGGMLLEAADVKLIKCFDALQMERVLTLGLLCCHPDADSRPTMRECCQFL

Gene3D: G3DSA:3.30.200.20
274-351 G3DSA:3.30.200.20

FTLFSFEELALATKNFSDKELLGRGGMGSVYKGVLSSDGSVVAVKLLANDSKESHHQFISELSIISRLQHKNLVSLRG

ProfileScan: PS50011
IPR000719
289-556 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDKELLGRGGMGSVYKGVLSSDGSVVAVKLLANDSKESHHQFISELSIISRLQHKNLVSLRGWCHEKSKLILVYEFMPNGSLDTILFDHRRVLQWDQRYNIAQGIAEALAFLHGGWEHKIVHRDVKAANVLLDADFVPRLGDFGLARFMDATTEDMTKVGTLGYIAPELAYTGRATVKSDVYGFGVVLLEIATGLHALDKSFEADGITLLDWVWKANTGGMLLEAADVKLIKCFDALQMERVLTLGLLCCHPDADSRPTMRECCQFL

HMMPfam: PF00069
IPR000719
291-554 Pkinase,Ser-thr
Protein kinase, catalytic domain

DKELLGRGGMGSVYKGVLSSDGSVVAVKLLANDSKESHHQFISELSIISRLQHKNLVSLRGWCHEKSKLILVYEFMPNGSLDTILFDHRRVLQWDQRYNIAQGIAEALAFLHGGWEHKIVHRDVKAANVLLDADFVPRLGDFGLARFMDATTEDMTKVGTLGYIAPELAYTGRATVKSDVYGFGVVLLEIATGLHALDKSFEADGITLLDWVWKANTGGMLLEAADVKLIKCFDALQMERVLTLGLLCCHPDADSRPTMRECCQ

PatternScan: PS00107
IPR017441
295-318 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGMGSVYKGVLSSDGSVVAVK

Gene3D: G3DSA:1.10.510.10
352-554 G3DSA:1.10.510.10

WCHEKSKLILVYEFMPNGSLDTILFDHRRVLQWDQRYNIAQGIAEALAFLHGGWEHKIVHRDVKAANVLLDADFVPRLGDFGLARFMDATTEDMTKVGTLGYIAPELAYTGRATVKSDVYGFGVVLLEIATGLHALDKSFEADGITLLDWVWKANTGGMLLEAADVKLIKCFDALQMERVLTLGLLCCHPDADSRPTMRECCQ

PatternScan: PS00108
IPR008271
409-421 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDVKAANVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox