PRGDB00182515 (77447)

From PRG Wiki
Jump to: navigation, search
77447
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Leucine-rich repeat transmembrane protein kinase (best arabidopsis hit)

DNA Sequence

AGCCTCTCCAAGCTCAGGCACCTCGGGCTCGCAGGAAATCAGCTCACGGGCTCCATCCCGGAAGAGCTTTGCACAATCTCGTCGCTCAAGTATCTAGACTTGAGTAGAAACCAGCTCCAGGGACCGGTTCCAGCCTGCCTCGGGAATTCTTCCAGTCTGAGAGTGCTCGACCTCGGATCAAACCGTCTACGGAGCCGGATACCGGCTGAGCTCGGACAACTTTCCAGCCTGCTCTATCTGAACTTGGAGAACAACCGCCTTCAAGGTGAAGTTCCGGAGTCGCTCGGGTCTCTTAGGTCGTTGCAAACTCTTCGATGCGGTAGAAACATGCTCGAGGGAGTCCTTCCCAGGCAGCTCGGACAGGCTCGGAGTTTACAGGTGCTGGATTTCTCGCTCAACTCCGATATCGCTGGAAGCATTCCTGCCTCACTTGGTAGCTTGAGTGACATCGTTGAGCTTTCCTTGTTCTCCATGGGATTGAACGGAACCATTCCCAGCGAACTCGGTAAGCTCCGGAACTTGTCAGCGCTTCGGCTCCATTCCAATTCCATCTCTGGCTCCATTCCCGGCTCGTTCTCGGAGCTTTCCAGTCTTAAAGTCCTCCAGGTCCAGGGAAATCAGCTCTCGGGATCACTTCCAAGCTCTGTTTTCAAGCAGCTCTCTGGTTTGCAAGGACTGTACCTCCAGATCAACTCCTTCACAGGTGTTTTGCCGGTGGAGATAACTCGGATGCCCAATCTGTCCGTCCTCAACCTCGGTTTCAACCAGCTGGATGGAGAGCTGCCTGAAACGCTCGGAAGCATGTCCAGTCTCGAGTGGCTGCTGCTCGGGAGCAATCGATTTTCCGTGGGATACTTTGTCGGGAATCCGACCTGTTCAGCGAGCTCTGCTTCCTGGGCCATCAGCCTCTCGGGTTCCACCGCCTCCTCACGGATCATCTCGACGAATTCCTCCACCAGTGGGATTGACTCGAGGTTCGTGGAAGCCACCCAGGAACTTTACACGACTGCTCGAGTAGGCGGCGACTCCATCGCCTACTATGGACGATGCCTGAAGCCCGGGAGCTATGCCGTCGAGCTCCACTTCATCGAGCTCGAAAACTACACTGTAGATTCCCCCGGAAGACGTGTCTTCGACGTGTTTCTCCAAGAGCAGCGTGTGCACGAGAAGCTGGACGTCTTCCGCGTCGCTGGAGGTCCCTTCGTTCCTCTCGTTCTGAAGTTCCAAGCTCGAGTTGGCGAAGAGTCCTCAACTTTGAAGCTGGAGCTACGAGGAACCGGGAGCTGGAACACTAGCGGCGCTGCTGGATCATACCACGGACCAACCATCTCGGCTATCCGAGTCTACGCGAACACCACGAGCTCCTTGGGCATTTCGGGTAACACATCCTCCTCTAGAATGGCTCGCGAGCTCTGGGCCATCCTTGGAACGAGTATAGGAATCCTCGCCATCCATTCGATCTCCATCGACCATATCCATCAGAGCTTGAGCAACTCCAACGCTGCCGCTCTTGCCACTTTCGAGTTCTCGGAGCTGGAAGAAGCCACGCAGAGGTTTAGCTCGGACAATCTTCTCGGGCAAGGAGCATATGGAAGAGTCTACAAGGGGTTCTTACCGGATGGGAAGATCGTGGCGATCAAGCAGCTCGTCCATCGCACCCCGACGTGCCAGCGCTGGTTCTACCACGAGCTCCAAGTGATCAGCTCGGTGCGCCACCGGAATCTCGTGCCTCTCATCGGCTGCTGCATCGATCGAGGGTTTCCACTCCTCGTCTGCGAATTCATGCCCAACGGGAGCCTCCAGGGCGCCCTCTTCGGTCGGGACAGCGGCATTTTCCTCGACTGGGAGCGGCGGCTCCAAATCGCGCTGGATGTGGCCCGGGGATTGCAGTACCTCCACGAAGATTGCGCCAAGGTGAGGATCATCCACCGCGATGTCAAGCCCGGAAATATCCTGCTGGACGAGGACATGCGAGCGCACATTTCGGATTTCGGCCTCGCCAAGCTGATCGCGCACCACGAGGAGGCCGAGGTCGTGGTGAGCTCCGTGATGGGCACCCGAGGATATCTCGCCCCAGAGTATGTGATTAATGGGCAGCTCTCGGAGAAGGTCGACGTCTACAGCTATGGGATCGTCCTCTTGGAGCTCGTCAGCGGCCGGCGAGGGATGCAATCCAGCGTGAATGTGGGCGCGCCGGAGCCCGTGTCGATCGACGAGTGGGCGTGGGAGGCGCTAGGGTCCAACAAGATCGAGGCCATGGCCGATCCGCGCTTCGGCCGCAAGTATTCCATGGATGCCATGGTGAGAATCGTCCAGATCGCGATGTGGTGCACCCAGGGCTTGCCCGAGCAGCGGCCATCCATGGGACAGGTCGTGGCGATGCTCGTTGGCCAGCTCGGGGTCCCGGAATTGCCGAGCGAGAGGATTTCCTGGGAGGAATTCAAGAGCGTGTTGGAATTTGGGGTGAAGATCGGTGGTGCTACTACGAGCAGCATTTGGGAGACGATGGATGGATCATACCAGACGGCGAACGAGGAGACTTTGCCGGATGTCCGCGAGGAGGAAGAGGTGAAGAAAGAGGATCGTTCACTCTCGATCGTTGCGCCTCCTCCAAGCGAAGAACTGGTAGCCGGCAATACTGTTTCTTCTTCCTAG


Protein sequences

Name Description Sequence
77447 Leucine-rich repeat transmembrane protein kinase (best arabidopsis hit)

SLSKLRHLGLAGNQLTGSIPEELCTISSLKYLDLSRNQLQGPVPACLGNSSSLRVLDLGSNRLRSRIPAELGQLSSLLYLNLENNRLQGEVPESLGSLRSLQTLRCGRNMLEGVLPRQLGQARSLQVLDFSLNSDIAGSIPASLGSLSDIVELSLFSMGLNGTIPSELGKLRNLSALRLHSNSISGSIPGSFSELSSLKVLQVQGNQLSGSLPSSVFKQLSGLQGLYLQINSFTGVLPVEITRMPNLSVLNLGFNQLDGELPETLGSMSSLEWLLLGSNRFSVGYFVGNPTCSASSASWAISLSGSTASSRIISTNSSTSGIDSRFVEATQELYTTARVGGDSIAYYGRCLKPGSYAVELHFIELENYTVDSPGRRVFDVFLQEQRVHEKLDVFRVAGGPFVPLVLKFQARVGEESSTLKLELRGTGSWNTSGAAGSYHGPTISAIRVYANTTSSLGISGNTSSSRMARELWAILGTSIGILAIHSISIDHIHQSLSNSNAAALATFEFSELEEATQRFSSDNLLGQGAYGRVYKGFLPDGKIVAIKQLVHRTPTCQRWFYHELQVISSVRHRNLVPLIGCCIDRGFPLLVCEFMPNGSLQGALFGRDSGIFLDWERRLQIALDVARGLQYLHEDCAKVRIIHRDVKPGNILLDEDMRAHISDFGLAKLIAHHEEAEVVVSSVMGTRGYLAPEYVINGQLSEKVDVYSYGIVLLELVSGRRGMQSSVNVGAPEPVSIDEWAWEALGSNKIEAMADPRFGRKYSMDAMVRIVQIAMWCTQGLPEQRPSMGQVVAMLVGQLGVPELPSERISWEEFKSVLEFGVKIGGATTSSIWETMDGSYQTANEETLPDVREEEEVKKEDRSLSIVAPPPSEELVAGNTVSSS*

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
1-144 G3DSA:3.80.10.10

SLSKLRHLGLAGNQLTGSIPEELCTISSLKYLDLSRNQLQGPVPACLGNSSSLRVLDLGSNRLRSRIPAELGQLSSLLYLNLENNRLQGEVPESLGSLRSLQTLRCGRNMLEGVLPRQLGQARSLQVLDFSLNSDIAGSIPASL

superfamily: SSF52047
3-282 SSF52047,LRR

SKLRHLGLAGNQLTGSIPEELCTISSLKYLDLSRNQLQGPVPACLGNSSSLRVLDLGSNRLRSRIPAELGQLSSLLYLNLENNRLQGEVPESLGSLRSLQTLRCGRNMLEGVLPRQLGQARSLQVLDFSLNSDIAGSIPASLGSLSDIVELSLFSMGLNGTIPSELGKLRNLSALRLHSNSISGSIPGSFSELSSLKVLQVQGNQLSGSLPSSVFKQLSGLQGLYLQINSFTGVLPVEITRMPNLSVLNLGFNQLDGELPETLGSMSSLEWLLLGSNRFS

HMMPfam: PF00560
IPR001611
4-23 LRR_1
Leucine-rich repeat

KLRHLGLAGNQLTGSIPEEL

HMMPanther: PTHR24420
10-813 PTHR24420,FAMILY NOT NAMED

LAGNQLTGSIPEELCTISSLKYLDLSRNQLQGPVPACLGNSSSLRVLDLGSNRLRSRIPAELGQLSSLLYLNLENNRLQGEVPESLGSLRSLQTLRCGRNMLEGVLPRQLGQARSLQVLDFSLNSDIAGSIPASLGSLSDIVELSLFSMGLNGTIPSELGKLRNLSALRLHSNSISGSIPGSFSELSSLKVLQVQGNQLSGSLPSSVFKQLSGLQGLYLQINSFTGVLPVEITRMPNLSVLNLGFNQLDGELPETLGSMSSLEWLLLGSNRFSVGYFVGNPTCSASSASWAISLSGSTASSRIISTNSSTSGIDSRFVEATQELYTTARVGGDSIAYYGRCLKPGSYAVELHFIELENYTVDSPGRRVFDVFLQEQRVHEKLDVFRVAGGPFVPLVLKFQARVGEESSTLKLELRGTGSWNTSGAAGSYHGPTISAIRVYANTTSSLGISGNTSSSRMARELWAILGTSIGILAIHSISIDHIHQSLSNSNAAALATFEFSELEEATQRFSSDNLLGQGAYGRVYKGFLPDGKIVAIKQLVHRTPTCQRWFYHELQVISSVRHRNLVPLIGCCIDRGFPLLVCEFMPNGSLQGALFGRDSGIFLDWERRLQIALDVARGLQYLHEDCAKVRIIHRDVKPGNILLDEDMRAHISDFGLAKLIAHHEEAEVVVSSVMGTRGYLAPEYVINGQLSEKVDVYSYGIVLLELVSGRRGMQSSVNVGAPEPVSIDEWAWEALGSNKIEAMADPRFGRKYSMDAMVRIVQIAMWCTQGLPEQRPSMGQVVAMLVGQLGVPELPSERISWEE

HMMPfam: PF13855
27-87 LRR_8,Leucine rich repeat

SSLKYLDLSRNQLQGPVPACLGNSSSLRVLDLGSNRLRSRIPAELGQLSSLLYLNLENNRL

Gene3D: G3DSA:3.80.10.10
145-282 G3DSA:3.80.10.10

GSLSDIVELSLFSMGLNGTIPSELGKLRNLSALRLHSNSISGSIPGSFSELSSLKVLQVQGNQLSGSLPSSVFKQLSGLQGLYLQINSFTGVLPVEITRMPNLSVLNLGFNQLDGELPETLGSMSSLEWLLLGSNRFS

HMMPfam: PF13855
172-232 LRR_8,Leucine rich repeat

RNLSALRLHSNSISGSIPGSFSELSSLKVLQVQGNQLSGSLPSSVFKQLSGLQGLYLQINS

HMMPfam: PF13516
244-266 LRR_6,Leucine Rich repeat

MPNLSVLNLGFNQLDGELPETLG

HMMPfam: PF11721
IPR021720
323-446 Malectin
Malectin

DSRFVEATQELYTTARVGGDSIAYYGRCLKPGSYAVELHFIELENYTVDSPGRRVFDVFLQEQRVHEKLDVFRVAGGPFVPLVLKFQARVGEESSTLKLELRGTGSWNTSGAAGSYHGPTISAI

superfamily: SSF56112
IPR011009
491-818 Kinase_like
Protein kinase-like domain

HIHQSLSNSNAAALATFEFSELEEATQRFSSDNLLGQGAYGRVYKGFLPDGKIVAIKQLVHRTPTCQRWFYHELQVISSVRHRNLVPLIGCCIDRGFPLLVCEFMPNGSLQGALFGRDSGIFLDWERRLQIALDVARGLQYLHEDCAKVRIIHRDVKPGNILLDEDMRAHISDFGLAKLIAHHEEAEVVVSSVMGTRGYLAPEYVINGQLSEKVDVYSYGIVLLELVSGRRGMQSSVNVGAPEPVSIDEWAWEALGSNKIEAMADPRFGRKYSMDAMVRIVQIAMWCTQGLPEQRPSMGQVVAMLVGQLGVPELPSERISWEEFKSVL

Gene3D: G3DSA:3.30.200.20
502-580 G3DSA:3.30.200.20

AALATFEFSELEEATQRFSSDNLLGQGAYGRVYKGFLPDGKIVAIKQLVHRTPTCQRWFYHELQVISSVRHRNLVPLIG

ProfileScan: PS50011
IPR000719
519-804 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSDNLLGQGAYGRVYKGFLPDGKIVAIKQLVHRTPTCQRWFYHELQVISSVRHRNLVPLIGCCIDRGFPLLVCEFMPNGSLQGALFGRDSGIFLDWERRLQIALDVARGLQYLHEDCAKVRIIHRDVKPGNILLDEDMRAHISDFGLAKLIAHHEEAEVVVSSVMGTRGYLAPEYVINGQLSEKVDVYSYGIVLLELVSGRRGMQSSVNVGAPEPVSIDEWAWEALGSNKIEAMADPRFGRKYSMDAMVRIVQIAMWCTQGLPEQRPSMGQVVAMLVGQLGVPEL

HMMPfam: PF00069
IPR000719
522-726 Pkinase,Ser-thr
Protein kinase, catalytic domain

DNLLGQGAYGRVYKGFLPDGKIVAIKQLVHRTPTCQRWFYHELQVISSVRHRNLVPLIGCCIDRGFPLLVCEFMPNGSLQGALFGRDSGIFLDWERRLQIALDVARGLQYLHEDCAKVRIIHRDVKPGNILLDEDMRAHISDFGLAKLIAHHEEAEVVVSSVMGTRGYLAPEYVINGQLSEKVDVYSYGIVLLELVSGRRGMQSS

PatternScan: PS00107
IPR017441
525-547 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGAYGRVYKGFLPDGKIVAIK

Gene3D: G3DSA:1.10.510.10
581-794 G3DSA:1.10.510.10

CCIDRGFPLLVCEFMPNGSLQGALFGRDSGIFLDWERRLQIALDVARGLQYLHEDCAKVRIIHRDVKPGNILLDEDMRAHISDFGLAKLIAHHEEAEVVVSSVMGTRGYLAPEYVINGQLSEKVDVYSYGIVLLELVSGRRGMQSSVNVGAPEPVSIDEWAWEALGSNKIEAMADPRFGRKYSMDAMVRIVQIAMWCTQGLPEQRPSMGQVVAM

PatternScan: PS00108
IPR008271
641-653 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDVKPGNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox