PRGDB00182516 (105905)

From PRG Wiki
Jump to: navigation, search
105905
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Integrin-linked protein kinase family (best arabidopsis hit)

DNA Sequence

ACGGTGAAGTTGCTCTACTGCGCGAGCCGTGGCGACGTAGAGGGTCTCCGCCAAGCTTTGCGAGAGGGCGTGAACAAGGACGTTGCCGACTATGACAAGAGGACCGCGCTACATTTGGCTGCCAGTGAGGGCCATGCCGACTGTGTGCTTCTTCTCATCCAGCATGGAGTCGATCTTAGCCCCAGAGATCGATGGGGACGAACGCCTCTAGCTGATGCGCGACGCTATGGACACATGCGTATTTGCAAGCTTCTCGAGGCCCACGAAGCCATGGACTATGTAATGATCTTGATTTCCTTTGTCAAGGAATCAGTTGTACCCGAGTACGAAATAGATCCTGGGGAGATTGAGAGGATTGGCAACAATGATCCCATCGGGAGAGGTGCTTTTGGGGAGATCCGAGTGGTCAAATGGCGAGGCACAAAGGTTGCTGCAAAGACGATCTTAACATCTCTCTTACAGGACAAGCAAGTCGTAAGAGAGTTCGTGAGGGAGCTCGTCTTGCTGCAAAAGCTCCATCATCCAAACATTGTCCAGTTTCTAGGAGCCGTCACTAAGCAAGAAAACCTGATCATAATCACAGAATACCTCCCCAAAGGCGACTTACAAGCTCTACTCAGAAGAAAGAGCAAAGGCTCCTTGGGCGGGAAACAAGTTCTTCATTTTGCTCTCGACATTGCAAGAGGCATGAATTTTCTTCACGAGCACAAGCCAGAGCCAGTTATACACCGGGACTTGAAGCCCACAAACATACTTCTGGACGACGCGGGCCATTTGAAAGTTGGCGATTTTGGATTGAGCAGGCTTGTTAAAGCCTCCGGCGCTACGGTGGACGAAGTCTACAAGATGACCGGAGAAACAGGATCTTCAGACAGGTATATGGCGCCGGAGGTGTTCAAGCATCAATCCTATGACAAGAGCGTCGACGTCTACTCGTTTGCTCTCATCGTCTATGAGATGTTTGAAGGTCATGTAGGGAATAGATATGAGAATCCAATTCACGCTGTGGAGGACAGGGCCAGGCATGGCTATAAACCAGCTTTCACAGCAAAGTATCCGACGAATATGAAACAGCTTCTCACTCGTTGCTTGGACTTTGATGCCAAAAAGAGGCCATCGTTTCGGGAAATAATTGCGGAACTGGAAGACATGGAGCGATCGCAAAAATTTGGCTGCAGCATCTCGTGA


Protein sequences

Name Description Sequence
105905 Integrin-linked protein kinase family (best arabidopsis hit)

TVKLLYCASRGDVEGLRQALREGVNKDVADYDKRTALHLAASEGHADCVLLLIQHGVDLSPRDRWGRTPLADARRYGHMRICKLLEAHEAMDYVMILISFVKESVVPEYEIDPGEIERIGNNDPIGRGAFGEIRVVKWRGTKVAAKTILTSLLQDKQVVREFVRELVLLQKLHHPNIVQFLGAVTKQENLIIITEYLPKGDLQALLRRKSKGSLGGKQVLHFALDIARGMNFLHEHKPEPVIHRDLKPTNILLDDAGHLKVGDFGLSRLVKASGATVDEVYKMTGETGSSDRYMAPEVFKHQSYDKSVDVYSFALIVYEMFEGHVGNRYENPIHAVEDRARHGYKPAFTAKYPTNMKQLLTRCLDFDAKKRPSFREIIAELEDMERSQKFGCSIS*

Domains

Domain Start-End Description Sequence

ProfileScan: PS50297
IPR020683
1-85 ANK_REP_REGION
Ankyrin repeat-containing domain

TVKLLYCASRGDVEGLRQALREGVNKDVADYDKRTALHLAASEGHADCVLLLIQHGVDLSPRDRWGRTPLADARRYGHMRICKLL

HMMPfam: PF12796
IPR020683
4-90 Ank_2,Ankyrin repeats (3 copies)
Ankyrin repeat-containing domain

LLYCASRGDVEGLRQALREGVNKDVADYDKRTALHLAASEGHADCVLLLIQHGVDLSPRDRWGRTPLADARRYGHMRICKLLEAHEA

superfamily: SSF48403
IPR020683
4-90 ANK
Ankyrin repeat-containing domain

LLYCASRGDVEGLRQALREGVNKDVADYDKRTALHLAASEGHADCVLLLIQHGVDLSPRDRWGRTPLADARRYGHMRICKLLEAHEA

Gene3D: G3DSA:1.25.40.20
IPR020683
4-90 ANK
Ankyrin repeat-containing domain

LLYCASRGDVEGLRQALREGVNKDVADYDKRTALHLAASEGHADCVLLLIQHGVDLSPRDRWGRTPLADARRYGHMRICKLLEAHEA

HMMPanther: PTHR23257:SF89
10-384 PTHR23257:SF89,ANKYRIN-KINASE

RGDVEGLRQALREGVNKDVADYDKRTALHLAASEGHADCVLLLIQHGVDLSPRDRWGRTPLADARRYGHMRICKLLEAHEAMDYVMILISFVKESVVPEYEIDPGEIERIGNNDPIGRGAFGEIRVVKWRGTKVAAKTILTSLLQDKQVVREFVRELVLLQKLHHPNIVQFLGAVTKQENLIIITEYLPKGDLQALLRRKSKGSLGGKQVLHFALDIARGMNFLHEHKPEPVIHRDLKPTNILLDDAGHLKVGDFGLSRLVKASGATVDEVYKMTGETGSSDRYMAPEVFKHQSYDKSVDVYSFALIVYEMFEGHVGNRYENPIHAVEDRARHGYKPAFTAKYPTNMKQLLTRCLDFDAKKRPSFREIIAELEDM

HMMPanther: PTHR23257
10-384 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

RGDVEGLRQALREGVNKDVADYDKRTALHLAASEGHADCVLLLIQHGVDLSPRDRWGRTPLADARRYGHMRICKLLEAHEAMDYVMILISFVKESVVPEYEIDPGEIERIGNNDPIGRGAFGEIRVVKWRGTKVAAKTILTSLLQDKQVVREFVRELVLLQKLHHPNIVQFLGAVTKQENLIIITEYLPKGDLQALLRRKSKGSLGGKQVLHFALDIARGMNFLHEHKPEPVIHRDLKPTNILLDDAGHLKVGDFGLSRLVKASGATVDEVYKMTGETGSSDRYMAPEVFKHQSYDKSVDVYSFALIVYEMFEGHVGNRYENPIHAVEDRARHGYKPAFTAKYPTNMKQLLTRCLDFDAKKRPSFREIIAELEDM

ProfileScan: PS50088
IPR002110
32-64 ANK_REPEAT
Ankyrin repeat

DKRTALHLAASEGHADCVLLLIQHGVDLSPRDR

HMMSmart: SM00248
IPR002110
32-61 ANK
Ankyrin repeat

DKRTALHLAASEGHADCVLLLIQHGVDLSP

HMMSmart: SM00248
IPR002110
65-95 ANK
Ankyrin repeat

WGRTPLADARRYGHMRICKLLEAHEAMDYVM

superfamily: SSF56112
IPR011009
105-379 Kinase_like
Protein kinase-like domain

VVPEYEIDPGEIERIGNNDPIGRGAFGEIRVVKWRGTKVAAKTILTSLLQDKQVVREFVRELVLLQKLHHPNIVQFLGAVTKQENLIIITEYLPKGDLQALLRRKSKGSLGGKQVLHFALDIARGMNFLHEHKPEPVIHRDLKPTNILLDDAGHLKVGDFGLSRLVKASGATVDEVYKMTGETGSSDRYMAPEVFKHQSYDKSVDVYSFALIVYEMFEGHVGNRYENPIHAVEDRARHGYKPAFTAKYPTNMKQLLTRCLDFDAKKRPSFREIIA

Gene3D: G3DSA:3.30.200.20
107-182 G3DSA:3.30.200.20

PEYEIDPGEIERIGNNDPIGRGAFGEIRVVKWRGTKVAAKTILTSLLQDKQVVREFVRELVLLQKLHHPNIVQFLG

ProfileScan: PS50011
IPR000719
119-390 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IGNNDPIGRGAFGEIRVVKWRGTKVAAKTILTSLLQDKQVVREFVRELVLLQKLHHPNIVQFLGAVTKQENLIIITEYLPKGDLQALLRRKSKGSLGGKQVLHFALDIARGMNFLHEHKPEPVIHRDLKPTNILLDDAGHLKVGDFGLSRLVKASGATVDEVYKMTGETGSSDRYMAPEVFKHQSYDKSVDVYSFALIVYEMFEGHVGNRYENPIHAVEDRARHGYKPAFTAKYPTNMKQLLTRCLDFDAKKRPSFREIIAELEDMERSQKF

HMMPfam: PF07714
IPR001245
122-381 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

NDPIGRGAFGEIRVVKWRGTKVAAKTILTSLLQDKQVVREFVRELVLLQKLHHPNIVQFLGAVTKQENLIIITEYLPKGDLQALLRRKSKGSLGGKQVLHFALDIARGMNFLHEHKPEPVIHRDLKPTNILLDDAGHLKVGDFGLSRLVKASGATVDEVYKMTGETGSSDRYMAPEVFKHQSYDKSVDVYSFALIVYEMFEGHVGNRYENPIHAVEDRARHGYKPAFTAKYPTNMKQLLTRCLDFDAKKRPSFREIIAEL

PatternScan: PS00107
IPR017441
125-146 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGRGAFGEIRVVKWRGTKVAAK

Gene3D: G3DSA:1.10.510.10
183-381 G3DSA:1.10.510.10

AVTKQENLIIITEYLPKGDLQALLRRKSKGSLGGKQVLHFALDIARGMNFLHEHKPEPVIHRDLKPTNILLDDAGHLKVGDFGLSRLVKASGATVDEVYKMTGETGSSDRYMAPEVFKHQSYDKSVDVYSFALIVYEMFEGHVGNRYENPIHAVEDRARHGYKPAFTAKYPTNMKQLLTRCLDFDAKKRPSFREIIAEL

PatternScan: PS00108
IPR008271
241-253 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDLKPTNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox