PRGDB00182517 (166734)

From PRG Wiki
Jump to: navigation, search
166734
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Selaginella moellendorffii

Comment?

Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

DNA Sequence

ATGGAGTTTTCCGGCCTTTTTCCGGCGGCCCTTGCGGCTCTGATCTACCTGAGCGTTGCTTCGTGCAACTCCGAAGGCGATGCCCTCTACGCGCTGCGAAGAAGCCTGATTGACCCGGAGAATGTTCTCCAGAGCTGGGACCCGACCCTTGTGAATCCTTGCACCTGGTTCCACGTTACCTGTGATCGTCGGAATCATGTGACTCGCGTGGATCTGGGCAATGCTAACCTCTCCGGCGTTCTCGTCCCGGAGCTTGGAAGCCTCCAGCATCTCCAATACCTGGAGCTCTACAAGAACAACATCCGGGGCAAGATCCCGGAGGAGCTCGGCCAACTCAAGAGCCTGGTGAGCCTGGACTTGTACATGAACAACTTCACAGGGGAGCTTCCAGCGTCCCTTGGCAACCTCAAGTCGCTCGTCTTCCTGCGGGTCAACAACAACCAGCTGAGAGGGCGAATCCCCCGTGAGCTCACCTCCATCGCGAGCCTTAAAGTCGTGGACGTTTCCTCGAACAACCTGTGCGGGACGATCCCGACTTCCGGCTCGTTCGCGAGATTCCCCGCAAAGAACTTTGAGAACAATCCCCGCCTGGACGGTCCAGAGCTGCAAGGCTCGGTCTTCTACGAGACCGCGTGTACATGA


Protein sequences

Name Description Sequence
166734 Leucine-rich repeat (LRR) family protein (best arabidopsis hit)

MEFSGLFPAALAALIYLSVASCNSEGDALYALRRSLIDPENVLQSWDPTLVNPCTWFHVTCDRRNHVTRVDLGNANLSGVLVPELGSLQHLQYLELYKNNIRGKIPEELGQLKSLVSLDLYMNNFTGELPASLGNLKSLVFLRVNNNQLRGRIPRELTSIASLKVVDVSSNNLCGTIPTSGSFARFPAKNFENNPRLDGPELQGSVFYETACT*


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
13-201 PTHR24420,FAMILY NOT NAMED

ALIYLSVASCNSEGDALYALRRSLIDPENVLQSWDPTLVNPCTWFHVTCDRRNHVTRVDLGNANLSGVLVPELGSLQHLQYLELYKNNIRGKIPEELGQLKSLVSLDLYMNNFTGELPASLGNLKSLVFLRVNNNQLRGRIPRELTSIASLKVVDVSSNNLCGTIPTSGSFARFPAKNFENNPRLDGPE

HMMPanther: PTHR24420:SF836
13-201 PTHR24420:SF836

ALIYLSVASCNSEGDALYALRRSLIDPENVLQSWDPTLVNPCTWFHVTCDRRNHVTRVDLGNANLSGVLVPELGSLQHLQYLELYKNNIRGKIPEELGQLKSLVSLDLYMNNFTGELPASLGNLKSLVFLRVNNNQLRGRIPRELTSIASLKVVDVSSNNLCGTIPTSGSFARFPAKNFENNPRLDGPE

superfamily: SSF52058
19-206 SSF52058,LRR

VASCNSEGDALYALRRSLIDPENVLQSWDPTLVNPCTWFHVTCDRRNHVTRVDLGNANLSGVLVPELGSLQHLQYLELYKNNIRGKIPEELGQLKSLVSLDLYMNNFTGELPASLGNLKSLVFLRVNNNQLRGRIPRELTSIASLKVVDVSSNNLCGTIPTSGSFARFPAKNFENNPRLDGPELQGSV

HMMPfam: PF08263
IPR013210
23-62 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NSEGDALYALRRSLIDPENVLQSWDPTLVNPCTWFHVTCD

Gene3D: G3DSA:3.80.10.10
24-187 G3DSA:3.80.10.10

SEGDALYALRRSLIDPENVLQSWDPTLVNPCTWFHVTCDRRNHVTRVDLGNANLSGVLVPELGSLQHLQYLELYKNNIRGKIPEELGQLKSLVSLDLYMNNFTGELPASLGNLKSLVFLRVNNNQLRGRIPRELTSIASLKVVDVSSNNLCGTIPTSGSFARFP

HMMPfam: PF12799
90-126 LRR_4,Leucine Rich repeats (2 copies)

HLQYLELYKNNIRGKIPEELGQLKSLVSLDLYMNNFT

HMMPfam: PF00560
IPR001611
162-180 LRR_1
Leucine-rich repeat

SLKVVDVSSNNLCGTIPTS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox