PRGDB00182519 (106578)

From PRG Wiki
Jump to: navigation, search
106578
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Sas10/U3 ribonucleoprotein (Utp) family protein (best arabidopsis hit)

DNA Sequence

AAACTCGATATTGCCCTTGACATCGCTCAAGGTTTACATTATATCCATTACGAGTTTGACAGCACGATCATTCACAGTGACTTCAAACCGGAGAACGTTCTACTTGATCAAGATTTCACCGCATGTATGACAGATTTTGGAATCTCAAGACTGGTTCAGGATAGCAATAACATTGCGACAGTAAGTACTTTCAAGGGAACAATCGGATATGCCCACCAGTAG


Protein sequences

Name Description Sequence
106578 Sas10/U3 ribonucleoprotein (Utp) family protein (best arabidopsis hit)

KLDIALDIAQGLHYIHYEFDSTIIHSDFKPENVLLDQDFTACMTDFGISRLVQDSNNIATVSTFKGTIGYAHQ*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-71 PTHR24420:SF474,SUBFAMILY NOT NAMED

KLDIALDIAQGLHYIHYEFDSTIIHSDFKPENVLLDQDFTACMTDFGISRLVQDSNNIATVSTFKGTIGYA

HMMPanther: PTHR24420
1-71 PTHR24420,FAMILY NOT NAMED

KLDIALDIAQGLHYIHYEFDSTIIHSDFKPENVLLDQDFTACMTDFGISRLVQDSNNIATVSTFKGTIGYA

ProfileScan: PS50011
IPR000719
1-73 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

KLDIALDIAQGLHYIHYEFDSTIIHSDFKPENVLLDQDFTACMTDFGISRLVQDSNNIATVSTFKGTIGYAHQ

superfamily: SSF56112
IPR011009
2-70 Kinase_like
Protein kinase-like domain

LDIALDIAQGLHYIHYEFDSTIIHSDFKPENVLLDQDFTACMTDFGISRLVQDSNNIATVSTFKGTIGY

HMMPfam: PF00069
IPR000719
3-71 Pkinase,Ser-thr
Protein kinase, catalytic domain

DIALDIAQGLHYIHYEFDSTIIHSDFKPENVLLDQDFTACMTDFGISRLVQDSNNIATVSTFKGTIGYA

Gene3D: G3DSA:1.10.510.10
3-71 G3DSA:1.10.510.10

DIALDIAQGLHYIHYEFDSTIIHSDFKPENVLLDQDFTACMTDFGISRLVQDSNNIATVSTFKGTIGYA

PatternScan: PS00108
IPR008271
23-35 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHSDFKPENVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox