PRGDB00182520 (129451)

From PRG Wiki
Jump to: navigation, search
129451
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGCGATACTCAATCGATTACTCGACAAGGCTGGGGCGTGGTACTGGTGGAACGGTGAGAGGGGGGATAAATCTTGACACTATGGAGAAGGTCGCCATCAAAGAGATGGTAGAGCATCTAAACCTACACGAGGAAACGAAGCTGGTCTATGGTCTTCTACAAGAATGTCAACATGAAAACATTGTCAAGCTTTTGGACGTGGGCTCGATTGGAGGTAAAACGTACATGGTGTTCGAGCACATGTTTGGGGATCTCTACAAGTTCAAGAAGAGATTGGGCATGCTTATGAAGAGAACCCTCAACAGGGAGGAGATCAAGACGATCATCGAGCAGATCCTTCAAGCCCTGGCCTACATGCACGAGCATGGCATCGTTCACCAGGATATCAAGACCGCCAACGTCCTGATCAACAAGGAGGGCACCAAGGTGAAGCTGTGCGACTTTGATCACGCGAGAAGGGTCACGACGCCCCCAAGAGACCCAGAAACGATTGGAACGCTGGCCTACAACGCGCCGGAGATCATCCTGGGCGACACCCAAGAGCTGGGAAGTGGCGTGGACGTGTGGAGCGCTGGAGTGATCCTCGCGGAGCTGGTTCTAGGGTACAACCCTTTCAGCGTTGTACGCGAGAGCCACGCCGCCAGAGAGCTTTACAGGGTGGTGGAGGAGATCAAGGAGAGGCTCCACAGGGAGATTGGCGACGAAGATATTCTTGAGCTGCTGGACAACATGCTGGTTTGGGAGCCGGAGGAGAGATGGAGTGCCGAGAGAGCTCTTTCTTCCACTTTCTTTGAGGATGGGACTCGCCAAATGTGTGGAGATCCATACCAGCAATTGACTTGTAAAATGGCCACACAATGCGTAATATAA


Protein sequences

Name Description Sequence
129451 Protein kinase superfamily protein (best arabidopsis hit)

MRYSIDYSTRLGRGTGGTVRGGINLDTMEKVAIKEMVEHLNLHEETKLVYGLLQECQHENIVKLLDVGSIGGKTYMVFEHMFGDLYKFKKRLGMLMKRTLNREEIKTIIEQILQALAYMHEHGIVHQDIKTANVLINKEGTKVKLCDFDHARRVTTPPRDPETIGTLAYNAPEIILGDTQELGSGVDVWSAGVILAELVLGYNPFSVVRESHAARELYRVVEEIKERLHREIGDEDILELLDNMLVWEPEERWSAERALSSTFFEDGTRQMCGDPYQQLTCKMATQCVI*

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
5-264 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IDYSTRLGRGTGGTVRGGINLDTMEKVAIKEMVEHLNLHEETKLVYGLLQECQHENIVKLLDVGSIGGKTYMVFEHMFGDLYKFKKRLGMLMKRTLNREEIKTIIEQILQALAYMHEHGIVHQDIKTANVLINKEGTKVKLCDFDHARRVTTPPRDPETIGTLAYNAPEIILGDTQELGSGVDVWSAGVILAELVLGYNPFSVVRESHAARELYRVVEEIKERLHREIGDEDILELLDNMLVWEPEERWSAERALSSTFF

Gene3D: G3DSA:3.30.200.20
8-111 G3DSA:3.30.200.20

STRLGRGTGGTVRGGINLDTMEKVAIKEMVEHLNLHEETKLVYGLLQECQHENIVKLLDVGSIGGKTYMVFEHMFGDLYKFKKRLGMLMKRTLNREEIKTIIEQ

HMMPanther: PTHR24361:SF97
9-266 PTHR24361:SF97,SUBFAMILY NOT NAMED

TRLGRGTGGTVRGGINLDTMEKVAIKEMVEHLNLHEETKLVYGLLQECQHENIVKLLDVGSIGGKTYMVFEHMFGDLYKFKKRLGMLMKRTLNREEIKTIIEQILQALAYMHEHGIVHQDIKTANVLINKEGTKVKLCDFDHARRVTTPPRDPETIGTLAYNAPEIILGDTQELGSGVDVWSAGVILAELVLGYNPFSVVRESHAARELYRVVEEIKERLHREIGDEDILELLDNMLVWEPEERWSAERALSSTFFED

HMMPfam: PF00069
IPR000719
9-264 Pkinase,Ser-thr
Protein kinase, catalytic domain

TRLGRGTGGTVRGGINLDTMEKVAIKEMVEHLNLHEETKLVYGLLQECQHENIVKLLDVGSIGGKTYMVFEHMFGDLYKFKKRLGMLMKRTLNREEIKTIIEQILQALAYMHEHGIVHQDIKTANVLINKEGTKVKLCDFDHARRVTTPPRDPETIGTLAYNAPEIILGDTQELGSGVDVWSAGVILAELVLGYNPFSVVRESHAARELYRVVEEIKERLHREIGDEDILELLDNMLVWEPEERWSAERALSSTFF

HMMPanther: PTHR24361
9-266 PTHR24361,MITOGEN-ACTIVATED KINASE KINASE KINASE

TRLGRGTGGTVRGGINLDTMEKVAIKEMVEHLNLHEETKLVYGLLQECQHENIVKLLDVGSIGGKTYMVFEHMFGDLYKFKKRLGMLMKRTLNREEIKTIIEQILQALAYMHEHGIVHQDIKTANVLINKEGTKVKLCDFDHARRVTTPPRDPETIGTLAYNAPEIILGDTQELGSGVDVWSAGVILAELVLGYNPFSVVRESHAARELYRVVEEIKERLHREIGDEDILELLDNMLVWEPEERWSAERALSSTFFED

superfamily: SSF56112
IPR011009
9-266 Kinase_like
Protein kinase-like domain

TRLGRGTGGTVRGGINLDTMEKVAIKEMVEHLNLHEETKLVYGLLQECQHENIVKLLDVGSIGGKTYMVFEHMFGDLYKFKKRLGMLMKRTLNREEIKTIIEQILQALAYMHEHGIVHQDIKTANVLINKEGTKVKLCDFDHARRVTTPPRDPETIGTLAYNAPEIILGDTQELGSGVDVWSAGVILAELVLGYNPFSVVRESHAARELYRVVEEIKERLHREIGDEDILELLDNMLVWEPEERWSAERALSSTFFED

PatternScan: PS00107
IPR017441
11-34 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGTGGTVRGGINLDTMEKVAIK

Gene3D: G3DSA:1.10.510.10
112-270 G3DSA:1.10.510.10

ILQALAYMHEHGIVHQDIKTANVLINKEGTKVKLCDFDHARRVTTPPRDPETIGTLAYNAPEIILGDTQELGSGVDVWSAGVILAELVLGYNPFSVVRESHAARELYRVVEEIKERLHREIGDEDILELLDNMLVWEPEERWSAERALSSTFFEDGTRQ

PatternScan: PS00108
IPR008271
124-136 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHQDIKTANVLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox