PRGDB00182522 (438129)

From PRG Wiki
Jump to: navigation, search
438129
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

FtsJ-like methyltransferase family protein (best arabidopsis hit)

DNA Sequence

ATGGATGCAGGTGGCCGCGTGAGGTCTGTGGTAATCGGCGTGGATCTGGTGCCGATTCGCCCCGTGAGAGCGCTCCAGGGCGATATCACCACTCCAAAATGCGCGTCGGATATTGGGAAGATTCTCGACCAGAATGGGTTGAGAATGGTCGATGTTGTGCTCCACGATGGCTCCCCCAATGTGGGAGGTGCCTGGGCCAAAGAAGCCATGACGCAGTCGTCTCTTGTCCTGGATTCTTTGAAGTTGGCTACCAAGTTTCTGGCTCCCAAAGGAACGTTTGTCACCAAGGTTTTTCGATCCCAAGATTATAACGCGCTGAAGTATGCATTTGAACAGCTGTTTGCCAAGGTGGAAGTAGCAAGTCGTTCGACATCAGCTGAAATATACGTGGTTGGTCTCAAGTATCTGGCACCCGTGAAAATCGATCCGCGTAACTTGGACCCTCGCTTTTTATTTGAAGAGATTCCTCAGCCCCCAAAGGTGGGTTTTGTTATTGTAAACAAGGTGCTTGCGCTAAAGCCGAGTAAATTGTGTAGATACGATGACGCTAACACTACCTTTCGTAAAGACTGCACGGCAGCAGACTTCGTCTGGTCCGAAAAACCTCTAGAGCTTCTTGGTAGCATCACGTCTATTTCGTTTGATGATCCGAAAAGTTCGCCAATCAAAGACCACGCTGAAACATCTGACGAGGTGGTCTGTGATGCTGTGCTCCCTGGGATGAAGTTAGTAGCCAGCATCTCTAAGGAGAACAAAGAGCCAGAGTACTTCTCACTGGAGTATGTTGAGGATCTTTTGGAGAGGTCTGGAGATCTTTTCGATGAGGAAGAAGAAGAGATATCATTTCTCTTCCTCGTCAATAGCAGCTTGGAAATCCACGGGACGAAAGGTGTTATGTGGTCCACTCCAACGATCGGTGGTGTTACTGATCAAGCAGGGTACCAGTTCCTCAAGATCTACTCGAATGGAGAGCCCCGGTTTACCTCGAGATCATTCAGCACCGGCAACAGCACGAAGAGCATCAACTTAAACCCGCTCTTCTTCGGGAAAAGCTCGCTTACTCGAACCTGTGGGATCTCGTTCGAGACAGCTGAAGGATGCCTCTGCATCGTTCACGAAGTACGTTTCTTCCGGGGACAAGGAGGGATGCAAGCACCTGTAAGAACCTGCGAGAACTCGCAACATTACTACATGCTCGAAGCCAAAGGACGATACTTCTACAAACCTCTAGATTTATCCAGTGCGCTCCACAACGTCACTCCAGCAGCGTGCATGGCCCTTTGTACCAAGCTGGAGATCTTCCGAAGCTCTCAACACCAGGCAACTCACAAAGTCGCCAAATACCAAAAACAGGCAAAGCCAGCCATCGTCGCGGTTTTCTCTGTGGCGACCATGGCTATAATCATCATCGCAATGGTGATCTGGAAGAAACAGATAAACTCGTACCTCAAACACTACAAACCATCGTTGATGCGCGTCTTTAATTACCCGGAGCTCCTCACTGCAACCAAAGCCTTCAGTGAGAAAATCGCAAGTGGAGGCGTTGGCACGGTTTTCGAAGGGATACTCTCCGTTGCCGTGAAACGGCTGGAGAGCTTCTCGAGCCAAGGATACAAACAGTTCAAGGCGGAGGAATCACACTACTTCCTGATTTACGAGTACGTAGCAAACGGATCGCTAGACAAGTGGATCTACAAGCCGCGGGAAGAGCTCAACTGGGACACGAGATTCAAGATAGTCGAGGAGATTGCTCGAGGGATGTGCTACCTCCACGAGGAATGCAGCACTAGAGTCCTGCACTTGGACATCAAGCCGCAAAACCTACTCCTGGACGAAAACTTTGGTGTCAAGATAGCAGAGTTTGGACTGTCGAGGATGGTAGAGCAAGGAGATCTAAGCGATGTCATGACAATGATCTGA


Protein sequences

Name Description Sequence
438129 FtsJ-like methyltransferase family protein (best arabidopsis hit)

MDAGGRVRSVVIGVDLVPIRPVRALQGDITTPKCASDIGKILDQNGLRMVDVVLHDGSPNVGGAWAKEAMTQSSLVLDSLKLATKFLAPKGTFVTKVFRSQDYNALKYAFEQLFAKVEVASRSTSAEIYVVGLKYLAPVKIDPRNLDPRFLFEEIPQPPKVGFVIVNKVLALKPSKLCRYDDANTTFRKDCTAADFVWSEKPLELLGSITSISFDDPKSSPIKDHAETSDEVVCDAVLPGMKLVASISKENKEPEYFSLEYVEDLLERSGDLFDEEEEEISFLFLVNSSLEIHGTKGVMWSTPTIGGVTDQAGYQFLKIYSNGEPRFTSRSFSTGNSTKSINLNPLFFGKSSLTRTCGISFETAEGCLCIVHEVRFFRGQGGMQAPVRTCENSQHYYMLEAKGRYFYKPLDLSSALHNVTPAACMALCTKLEIFRSSQHQATHKVAKYQKQAKPAIVAVFSVATMAIIIIAMVIWKKQINSYLKHYKPSLMRVFNYPELLTATKAFSEKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMVEQGDLSDVMTMI*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10920:SF13
7-233 PTHR10920:SF13,RRNA METHYLTRANSFERASE 3

VRSVVIGVDLVPIRPVRALQGDITTPKCASDIGKILDQNGLRMVDVVLHDGSPNVGGAWAKEAMTQSSLVLDSLKLATKFLAPKGTFVTKVFRSQDYNALKYAFEQLFAKVEVASRSTSAEIYVVGLKYLAPVKIDPRNLDPRFLFEEIPQPPKVGFVIVNKVLALKPSKLCRYDDANTTFRKDCTAADFVWSEKPLELLGSITSISFDDPKSSPIKDHAETSDEVV

HMMPanther: PTHR10920
IPR015507
7-233 rRNA-MeTfrase_J
Ribosomal RNA large subunit methyltransferase E

VRSVVIGVDLVPIRPVRALQGDITTPKCASDIGKILDQNGLRMVDVVLHDGSPNVGGAWAKEAMTQSSLVLDSLKLATKFLAPKGTFVTKVFRSQDYNALKYAFEQLFAKVEVASRSTSAEIYVVGLKYLAPVKIDPRNLDPRFLFEEIPQPPKVGFVIVNKVLALKPSKLCRYDDANTTFRKDCTAADFVWSEKPLELLGSITSISFDDPKSSPIKDHAETSDEVV

Gene3D: G3DSA:3.40.50.150
8-135 G3DSA:3.40.50.150

RSVVIGVDLVPIRPVRALQGDITTPKCASDIGKILDQNGLRMVDVVLHDGSPNVGGAWAKEAMTQSSLVLDSLKLATKFLAPKGTFVTKVFRSQDYNALKYAFEQLFAKVEVASRSTSAEIYVVGLKY

HMMPfam: PF01728
IPR002877
8-134 FtsJ
Ribosomal RNA methyltransferase RrmJ/FtsJ

RSVVIGVDLVPIRPVRALQGDITTPKCASDIGKILDQNGLRMVDVVLHDGSPNVGGAWAKEAMTQSSLVLDSLKLATKFLAPKGTFVTKVFRSQDYNALKYAFEQLFAKVEVASRSTSAEIYVVGLK

superfamily: SSF53335
11-137 SSF53335

VIGVDLVPIRPVRALQGDITTPKCASDIGKILDQNGLRMVDVVLHDGSPNVGGAWAKEAMTQSSLVLDSLKLATKFLAPKGTFVTKVFRSQDYNALKYAFEQLFAKVEVASRSTSAEIYVVGLKYLA

HMMPfam: PF11861
IPR024576
180-232 DUF3381
Ribosomal RNA methyltransferase Spb1, domain of un

YDDANTTFRKDCTAADFVWSEKPLELLGSITSISFDDPKSSPIKDHAETSDEV

ProfileScan: PS50011
IPR000719
431-639 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LEIFRSSQHQATHKVAKYQKQAKPAIVAVFSVATMAIIIIAMVIWKKQINSYLKHYKPSLMRVFNYPELLTATKAFSEKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMVEQGDLSDVMTMI

superfamily: SSF56112
IPR011009
476-631 Kinase_like
Protein kinase-like domain

KKQINSYLKHYKPSLMRVFNYPELLTATKAFSEKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMVEQGD

Gene3D: G3DSA:3.30.200.20
488-544 G3DSA:3.30.200.20

PSLMRVFNYPELLTATKAFSEKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAE

HMMPfam: PF00069
IPR000719
540-628 Pkinase,Ser-thr
Protein kinase, catalytic domain

QFKAEESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMVE

Gene3D: G3DSA:1.10.510.10
545-633 G3DSA:1.10.510.10

ESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMVEQGDLS

PatternScan: PS00108
IPR008271
598-610 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHLDIKPQNLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox