PRGDB00182523 (438131)

From PRG Wiki
Jump to: navigation, search
438131
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

S-domain-2 5 (best arabidopsis hit)

DNA Sequence

ATGGCCAAAGTGTTTCTTCTTTCCGCCCTCCTCTTTGGCCTGCTGCTCTTCGTAGCCGATGCATCTCGCAACATTGAGCTGACTGACAAGGAGAGCGATGTGACTTACATCGTTGAGGGGTCTCGTGAAGGTAGTAACGAGGCTGCTGGTCTCAATGTTGTCATCCCCTCCAAACACGGCCTCCAAGATAAGTACTGCTGCCTGAAGGATGGTTTGGGATCATGTGTTCAGGAGTGCGACTCCAAGATCAAATACTACTGCTGCCTCAAGAATGGACTCGGCGGCTGCCTGCAACTTTGCGAGACCAATGTCAAATACTTCTGCTGCCTCAAGAACCCTCTTGGTACCTGCTTTCAGCTGTGCGACTCGTCCAAGAAACACTACTGCTGCAAGAAGAACCCTTTTGGTACCTGCCTTGGAATGTGCCCCAAAACGGTAGCTTGCCATGCCATTGCTGCTGGATCGTCCATTGGGAGACAAGTAGCTTTGAACAAGTCCTCATTCAACTCGATTCATAAGATCGTCCGCTGGTTCTCCTTGGACAATGCCAACAGGAATCCACAGCCAAGCCAAGCACAAGCTGGGTACCTATCCACGTCGCTCAGCACCAGGTCGCCATCGCTGGAGGCAGGAAGGGGTGCTGAAGCCAAGGCTAATTCGAAATATCTGGAGTGGATTCGAGAGTGGAGCTTGGAGGAAGATGGTGCTTCCAGTGACATTGGAAGCTTTGTGTGGTTGACCAACACGGGAGGATCTGGAGCGCAAGTCTTGGCCCTCGAGAGCTCTGGAAATCTCGTCATCCGGAGCAAAATTGGAGCTTTCCTGTGGCAGAGCTTTGATCATCCCTGTGATGCTGTGCTCCCTGGGATGAAGTTAGTAGCCAGCATCTCTAGGAGAACAAAGAGCCAGGGTACTTCTCACTCGAGCTTGGAAATCCACGGGACGAAAGGTGTTATGTGGTCCACTCCAACGATCGGTGGTGTTACTGATCAAACAGGGCACCAGTTCCTCAAGATCTACTCGAATGGAGAGCCCCGGTTTACCTCGAGATCATTCAGCACCGGCAACAGCACGAAGAGCATCAACTTAAACCCCCTCTTCTTCGGGAAAAGCTCGCTTACTCGAACCTGTGGGATCTCGTTCGAGACAGCTGAAGGATGCCTCTGCATCGTTCACGAAGTACGTTTCTTCCGGGAACAAGGAGGGATGCAAGCACCTGGAAGAACCTGCGAGAACTCGCAACATCACTACATGCTCGAAGCCACAGTACGATACTTCTACAAACCTCTAGATTTATCCAGTGCGCTCCACAACGTCACTCCAGCAGCGTGCATGGCCCTGTGTATCAAAAACTGTTCGTGCAAAGGGATGATCGAAGTTTTTTCTCTGAACAAAACTCGCAACGTCGTCGATCAAGCTTTGCTGTTTTCGATCAAGCTGTACCAAGCTGGAGATCTTCCGAAGCTCAACTCACAAAGTCGCCAAATAAACTCGTATCTCAAACACTACAAACCATCGTTTCCGTTCGGTGCTATGGACGTGGTGCACGTCTTCAATTACCCGGAGCTCCTCACTGCAACCAAAGCCTTCAGTGAGAAAATCGCAAGTGGAGGCGTTGGCACGGTTTTCGAAGGGATACTCTCCGTTGCCGTGAAACGGCTGGAGAGCTTCTCGAGCCAAGGATACAAACAGTTCAAGGCGGAGGAATCACACTACTTCCTGATTTACGAGTACGTAGCAAACGGATCGCTAGACAAGTGGATCTACAAGCCGCGGGAAGAGCTCAACTGGGACACGAGATTCAAGATAGTCGAGGAGATTGCTCGAGGGATGTGCTACCTCCACGAGGAATGCAGCACTAGAGTCCTGCACTTGGACATCAAGCCGCAAAACCTACTCCTGGACGAAAACTTTGGTGTCAAGATAGCAGAGTTTGGACTGTCGAGGATGATGAGAGTGAGAGACAAACTGGACATCTACAGCTTTGGGATCCTTGTGCTGGAAGTGGCTAGCGGACTTCAAGCTTTCCATACCTGTGTGTCTTGCGGGAGGAGCCCAAAGTTCCTGGCGGTTTGA


Protein sequences

Name Description Sequence
438131 S-domain-2 5 (best arabidopsis hit)

MAKVFLLSALLFGLLLFVADASRNIELTDKESDVTYIVEGSREGSNEAAGLNVVIPSKHGLQDKYCCLKDGLGSCVQECDSKIKYYCCLKNGLGGCLQLCETNVKYFCCLKNPLGTCFQLCDSSKKHYCCKKNPFGTCLGMCPKTVACHAIAAGSSIGRQVALNKSSFNSIHKIVRWFSLDNANRNPQPSQAQAGYLSTSLSTRSPSLEAGRGAEAKANSKYLEWIREWSLEEDGASSDIGSFVWLTNTGGSGAQVLALESSGNLVIRSKIGAFLWQSFDHPCDAVLPGMKLVASISRRTKSQGTSHSSLEIHGTKGVMWSTPTIGGVTDQTGHQFLKIYSNGEPRFTSRSFSTGNSTKSINLNPLFFGKSSLTRTCGISFETAEGCLCIVHEVRFFREQGGMQAPGRTCENSQHHYMLEATVRYFYKPLDLSSALHNVTPAACMALCIKNCSCKGMIEVFSLNKTRNVVDQALLFSIKLYQAGDLPKLNSQSRQINSYLKHYKPSFPFGAMDVVHVFNYPELLTATKAFSEKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVASGLQAFHTCVSCGRSPKFLAV*

Domains

Domain Start-End Description Sequence

HMMSmart: SM00108
IPR001480
159-282 B_lectin
Bulb-type lectin domain

RQVALNKSSFNSIHKIVRWFSLDNANRNPQPSQAQAGYLSTSLSTRSPSLEAGRGAEAKANSKYLEWIREWSLEEDGASSDIGSFVWLTNTGGSGAQVLALESSGNLVIRSKIGAFLWQSFDHP

HMMPanther: PTHR24420:SF442
226-672 PTHR24420:SF442,SUBFAMILY NOT NAMED

IREWSLEEDGASSDIGSFVWLTNTGGSGAQVLALESSGNLVIRSKIGAFLWQSFDHPCDAVLPGMKLVASISRRTKSQGTSHSSLEIHGTKGVMWSTPTIGGVTDQTGHQFLKIYSNGEPRFTSRSFSTGNSTKSINLNPLFFGKSSLTRTCGISFETAEGCLCIVHEVRFFREQGGMQAPGRTCENSQHHYMLEATVRYFYKPLDLSSALHNVTPAACMALCIKNCSCKGMIEVFSLNKTRNVVDQALLFSIKLYQAGDLPKLNSQSRQINSYLKHYKPSFPFGAMDVVHVFNYPELLTATKAFSEKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVASG

HMMPanther: PTHR24420
226-672 PTHR24420,FAMILY NOT NAMED

IREWSLEEDGASSDIGSFVWLTNTGGSGAQVLALESSGNLVIRSKIGAFLWQSFDHPCDAVLPGMKLVASISRRTKSQGTSHSSLEIHGTKGVMWSTPTIGGVTDQTGHQFLKIYSNGEPRFTSRSFSTGNSTKSINLNPLFFGKSSLTRTCGISFETAEGCLCIVHEVRFFREQGGMQAPGRTCENSQHHYMLEATVRYFYKPLDLSSALHNVTPAACMALCIKNCSCKGMIEVFSLNKTRNVVDQALLFSIKLYQAGDLPKLNSQSRQINSYLKHYKPSFPFGAMDVVHVFNYPELLTATKAFSEKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVASG

superfamily: SSF51110
IPR001480
241-322 B_lectin
Bulb-type lectin domain

GSFVWLTNTGGSGAQVLALESSGNLVIRSKIGAFLWQSFDHPCDAVLPGMKLVASISRRTKSQGTSHSSLEIHGTKGVMWST

HMMPfam: PF01453
IPR001480
241-309 B_lectin
Bulb-type lectin domain

GSFVWLTNTGGSGAQVLALESSGNLVIRSKIGAFLWQSFDHPCDAVLPGMKLVASISRRTKSQGTSHSS

Gene3D: G3DSA:2.90.10.10
IPR001480
241-284 Bulb-type_lectin_dom
Bulb-type lectin domain

GSFVWLTNTGGSGAQVLALESSGNLVIRSKIGAFLWQSFDHPCD

Gene3D: G3DSA:2.90.10.10
IPR001480
333-348 Bulb-type_lectin_dom
Bulb-type lectin domain

GHQFLKIYSNGEPRFT

ProfileScan: PS50011
IPR000719
449-691 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IKNCSCKGMIEVFSLNKTRNVVDQALLFSIKLYQAGDLPKLNSQSRQINSYLKHYKPSFPFGAMDVVHVFNYPELLTATKAFSEKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVASGLQAFHTCVSCGRSPKFLAV

superfamily: SSF56112
IPR011009
502-677 Kinase_like
Protein kinase-like domain

HYKPSFPFGAMDVVHVFNYPELLTATKAFSEKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVASGLQAFH

Gene3D: G3DSA:3.30.200.20
514-568 G3DSA:3.30.200.20

VVHVFNYPELLTATKAFSEKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAE

HMMPfam: PF00069
IPR000719
564-651 Pkinase,Ser-thr
Protein kinase, catalytic domain

QFKAEESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMM

Gene3D: G3DSA:1.10.510.10
569-672 G3DSA:1.10.510.10

ESHYFLIYEYVANGSLDKWIYKPREELNWDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVASG

PatternScan: PS00108
IPR008271
622-634 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHLDIKPQNLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox