PRGDB00182524 (76873)

From PRG Wiki
Jump to: navigation, search
76873
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

STRUBBELIG-receptor family 8 (best arabidopsis hit)

DNA Sequence

GTTAATGGGCTTAAGATCCTCTATGGAAGCTGGAATTCTCCGCGGCTATCTGGGTGGAACTCTGGGCCCGGTGGTGATCCATGCGGCGAATCATGGCAAGGAGTGCTATGTACGGGTCCTCGGGTTACCTCAATTAAGCTTCCCGGTCAGAATTTGGGAGGGTCCTTGGGATACGCGTTGGATCAGCTCCGGAACCTCAAGATACTGGATTTGAGCAACAATCAACTCAGTCAAGCGATCCCGTACCAGCTTCCGCCACAACTACAAGAGATGTACTTGTCTAATAACCAGTTGACTGGTCTTCCATACTCTCTGAAAGATTTGTGGTCTCTAACGAAAATAGACGTGAGCCATAACCAGTTAATTGGTACAATTCCTGATGTCTTTCAAAACTTCTCCAACTTGAATCTTCTAGACGTGTCCTTTAATCAACTTACTGGCTCGCTTCCTTCCTCATTTGCGGGTTTGATTAGCATATCCGTTATGCACGTCCAGAACAATAAACTCAGCGGGGATATTAACGTACTGTCTGATTTGCCTCTTGCTGACTTAAACGTTGAAAATAATCAGTTTAATGGATGGGTTCCAAGCTCACTTCGATCTATTCCCAACTTAAGGGACGGTGGGAACAATTTTAGTACTTCGCCGGCTCCCCCTCCACCTCCTTTCACGCCTCCTCCACCTCCACCACGAGCACAAGCTGGAGGAAAAAGTCCTGGGGCCAAGTCTTCACCAAGGCAGTCTAAAGACGCTGAAAGTGGCGGTTTGTCACAAGGAACAATGGCTGGTATAATTGTTGCATTGGTATTGGCTGCTGTTATCGCTGGCCTTGTCGCTGTATGCTACATGCGTAAGAGAAAAGGAAAACCGGACCTGGAAAAGAAAATGGAGAGCTCATGGCTAACTCCTCATAATGCTCCTGCTAAAGTGAAAGAGCTTAAAATGGAACAGAAAACAAGACTTTCTCCTCCCGAAAAAGTCTTAAAGCCACCACCGCTAAAGACTCCAGCTGCTGAGCGTAGTCCTATAAAACACAAAAATTCGAAGGCGTCGGTTGCTGCAACTTCTTACTCCGTCGCCGATCTTCAGGCTGCCACGAACAGCTTTGCGCAAGAAAATCTTTTGGGTGAAGGTTCTTTGGGAAGAGTCTATCGTGCAGAGCTTCAAAATGGCACGCCGTTAGCTGTCAAGAAGCTCGACGCATCAGGATCCACGGTACAAACAAATGAAGAGTTTCTTGCATTTGTTTCTACCATTGCTCGTCTGCGGCACACAAATGTTACAGAGCTTGTCGGATACTGTGCAGAGCATGGACAACGGCTGCTCGTGTATGAGTATTTCAACAGAGGAACACTTCATGAGATGTTGCACGTTCTTGATGAGACGAGTAAACGGCTATCATGGAATCAACGAGTCAAAATTGCGTTAGGAGCTGCGCGAGCACTTGAGTATTTGCACGAGGTATGTTCGCCAGCGGTTGTACATCGCAATTTTAAGTCCGCCAACATTCTACTCGACGATGATATGAGTCCACATTTAACTGACTGTGGGCTTGCAGCTTTGAGAAAAAACTGGCAGGTTGCGGCACAAATGCTGGGTTCCTTTGGCTACAGTGCTCCTGAGTTTGCAATGTCTGGTGTTTATACCGTTAAAAGCGATGTGTACAGTTTTGGAGTGGTGATGCTGGAGCTACTGACAGGGCGTAAGCCTCTGGACAGTTCAAGAGCACGCTCGGAGCAGTCGCTGGTGAGATGGGCCACACCTCAACTCCACGATATTGATGCGCTGTCTAAAATGGTGGACCCTGCGTTGAAAGGCATCTATCCAGCCAAGTCTTTGTCTCGCTTCGCAGACGTTATCTCGTCGTGTGTTCAGCCTGAGCCCGAGTTTAGGCCTCCAATGTCCGAGGTTGTCCAGTCTCTAGTCCGGTTGATGCAACGGGCCAGCCTCAGCAAGCGGAGCTCGGGCGATGAGCTTGGTGGTTCTCAAAGAAGCATGCACGACCCGCCTTCAGACTACTGA


Protein sequences

Name Description Sequence
76873 STRUBBELIG-receptor family 8 (best arabidopsis hit)

VNGLKILYGSWNSPRLSGWNSGPGGDPCGESWQGVLCTGPRVTSIKLPGQNLGGSLGYALDQLRNLKILDLSNNQLSQAIPYQLPPQLQEMYLSNNQLTGLPYSLKDLWSLTKIDVSHNQLIGTIPDVFQNFSNLNLLDVSFNQLTGSLPSSFAGLISISVMHVQNNKLSGDINVLSDLPLADLNVENNQFNGWVPSSLRSIPNLRDGGNNFSTSPAPPPPPFTPPPPPPRAQAGGKSPGAKSSPRQSKDAESGGLSQGTMAGIIVALVLAAVIAGLVAVCYMRKRKGKPDLEKKMESSWLTPHNAPAKVKELKMEQKTRLSPPEKVLKPPPLKTPAAERSPIKHKNSKASVAATSYSVADLQAATNSFAQENLLGEGSLGRVYRAELQNGTPLAVKKLDASGSTVQTNEEFLAFVSTIARLRHTNVTELVGYCAEHGQRLLVYEYFNRGTLHEMLHVLDETSKRLSWNQRVKIALGAARALEYLHEVCSPAVVHRNFKSANILLDDDMSPHLTDCGLAALRKNWQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPEFRPPMSEVVQSLVRLMQRASLSKRSSGDELGGSQRSMHDPPSDY*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-673 PTHR24420,FAMILY NOT NAMED

VNGLKILYGSWNSPRLSGWNSGPGGDPCGESWQGVLCTGPRVTSIKLPGQNLGGSLGYALDQLRNLKILDLSNNQLSQAIPYQLPPQLQEMYLSNNQLTGLPYSLKDLWSLTKIDVSHNQLIGTIPDVFQNFSNLNLLDVSFNQLTGSLPSSFAGLISISVMHVQNNKLSGDINVLSDLPLADLNVENNQFNGWVPSSLRSIPNLRDGGNNFSTSPAPPPPPFTPPPPPPRAQAGGKSPGAKSSPRQSKDAESGGLSQGTMAGIIVALVLAAVIAGLVAVCYMRKRKGKPDLEKKMESSWLTPHNAPAKVKELKMEQKTRLSPPEKVLKPPPLKTPAAERSPIKHKNSKASVAATSYSVADLQAATNSFAQENLLGEGSLGRVYRAELQNGTPLAVKKLDASGSTVQTNEEFLAFVSTIARLRHTNVTELVGYCAEHGQRLLVYEYFNRGTLHEMLHVLDETSKRLSWNQRVKIALGAARALEYLHEVCSPAVVHRNFKSANILLDDDMSPHLTDCGLAALRKNWQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPEFRPPMSEVVQSLVRLMQRASLSKRSSGDELGGSQRSMHDPPSDY

HMMPanther: PTHR24420:SF463
1-673 PTHR24420:SF463,SUBFAMILY NOT NAMED

VNGLKILYGSWNSPRLSGWNSGPGGDPCGESWQGVLCTGPRVTSIKLPGQNLGGSLGYALDQLRNLKILDLSNNQLSQAIPYQLPPQLQEMYLSNNQLTGLPYSLKDLWSLTKIDVSHNQLIGTIPDVFQNFSNLNLLDVSFNQLTGSLPSSFAGLISISVMHVQNNKLSGDINVLSDLPLADLNVENNQFNGWVPSSLRSIPNLRDGGNNFSTSPAPPPPPFTPPPPPPRAQAGGKSPGAKSSPRQSKDAESGGLSQGTMAGIIVALVLAAVIAGLVAVCYMRKRKGKPDLEKKMESSWLTPHNAPAKVKELKMEQKTRLSPPEKVLKPPPLKTPAAERSPIKHKNSKASVAATSYSVADLQAATNSFAQENLLGEGSLGRVYRAELQNGTPLAVKKLDASGSTVQTNEEFLAFVSTIARLRHTNVTELVGYCAEHGQRLLVYEYFNRGTLHEMLHVLDETSKRLSWNQRVKIALGAARALEYLHEVCSPAVVHRNFKSANILLDDDMSPHLTDCGLAALRKNWQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPEFRPPMSEVVQSLVRLMQRASLSKRSSGDELGGSQRSMHDPPSDY

Gene3D: G3DSA:3.80.10.10
24-215 G3DSA:3.80.10.10

GGDPCGESWQGVLCTGPRVTSIKLPGQNLGGSLGYALDQLRNLKILDLSNNQLSQAIPYQLPPQLQEMYLSNNQLTGLPYSLKDLWSLTKIDVSHNQLIGTIPDVFQNFSNLNLLDVSFNQLTGSLPSSFAGLISISVMHVQNNKLSGDINVLSDLPLADLNVENNQFNGWVPSSLRSIPNLRDGGNNFSTS

superfamily: SSF52058
26-206 SSF52058,LRR

DPCGESWQGVLCTGPRVTSIKLPGQNLGGSLGYALDQLRNLKILDLSNNQLSQAIPYQLPPQLQEMYLSNNQLTGLPYSLKDLWSLTKIDVSHNQLIGTIPDVFQNFSNLNLLDVSFNQLTGSLPSSFAGLISISVMHVQNNKLSGDINVLSDLPLADLNVENNQFNGWVPSSLRSIPNLR

ProfileScan: PS51450
IPR001611
65-86 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLKILDLSNNQLSQAIPYQLPP

HMMPfam: PF00560
IPR001611
65-82 LRR_1
Leucine-rich repeat

NLKILDLSNNQLSQAIPY

HMMPfam: PF13855
86-145 LRR_8,Leucine rich repeat

PQLQEMYLSNNQLTGLPYSLKDLWSLTKIDVSHNQLIGTIPDVFQNFSNLNLLDVSFNQL

ProfileScan: PS51450
IPR001611
87-109 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQEMYLSNNQLTGLPYSLKDLW

ProfileScan: PS51450
IPR001611
110-132 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTKIDVSHNQLIGTIPDVFQNF

ProfileScan: PS51450
IPR001611
134-156 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLNLLDVSFNQLTGSLPSSFAGL

ProfileScan: PS51450
IPR001611
158-180 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SISVMHVQNNKLSGDINVLSDLP

Gene3D: G3DSA:2.60.120.200
IPR013320
216-291 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

PAPPPPPFTPPPPPPRAQAGGKSPGAKSSPRQSKDAESGGLSQGTMAGIIVALVLAAVIAGLVAVCYMRKRKGKPD

superfamily: SSF56112
IPR011009
339-649 Kinase_like
Protein kinase-like domain

ERSPIKHKNSKASVAATSYSVADLQAATNSFAQENLLGEGSLGRVYRAELQNGTPLAVKKLDASGSTVQTNEEFLAFVSTIARLRHTNVTELVGYCAEHGQRLLVYEYFNRGTLHEMLHVLDETSKRLSWNQRVKIALGAARALEYLHEVCSPAVVHRNFKSANILLDDDMSPHLTDCGLAALRKNWQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPEFRPPMSEVVQSLVRLMQRAS

Gene3D: G3DSA:2.60.120.200
IPR013320
342-388 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

PIKHKNSKASVAATSYSVADLQAATNSFAQENLLGEGSLGRVYRAEL

ProfileScan: PS50011
IPR000719
369-644 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAQENLLGEGSLGRVYRAELQNGTPLAVKKLDASGSTVQTNEEFLAFVSTIARLRHTNVTELVGYCAEHGQRLLVYEYFNRGTLHEMLHVLDETSKRLSWNQRVKIALGAARALEYLHEVCSPAVVHRNFKSANILLDDDMSPHLTDCGLAALRKNWQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPEFRPPMSEVVQSLVRL

HMMPfam: PF00069
IPR000719
372-640 Pkinase,Ser-thr
Protein kinase, catalytic domain

ENLLGEGSLGRVYRAELQNGTPLAVKKLDASGSTVQTNEEFLAFVSTIARLRHTNVTELVGYCAEHGQRLLVYEYFNRGTLHEMLHVLDETSKRLSWNQRVKIALGAARALEYLHEVCSPAVVHRNFKSANILLDDDMSPHLTDCGLAALRKNWQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPEFRPPMSEVVQS

Gene3D: G3DSA:3.30.200.20
389-433 G3DSA:3.30.200.20

QNGTPLAVKKLDASGSTVQTNEEFLAFVSTIARLRHTNVTELVGY

Gene3D: G3DSA:1.10.510.10
434-645 G3DSA:1.10.510.10

CAEHGQRLLVYEYFNRGTLHEMLHVLDETSKRLSWNQRVKIALGAARALEYLHEVCSPAVVHRNFKSANILLDDDMSPHLTDCGLAALRKNWQVAAQMLGSFGYSAPEFAMSGVYTVKSDVYSFGVVMLELLTGRKPLDSSRARSEQSLVRWATPQLHDIDALSKMVDPALKGIYPAKSLSRFADVISSCVQPEPEFRPPMSEVVQSLVRLM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox