PRGDB00182525 (438187)

From PRG Wiki
Jump to: navigation, search
438187
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

S-domain-2 5 (best arabidopsis hit)

DNA Sequence

ATGGCCAAAGTGTTTCTTCTTTCCGCCCTCCTCGTTGGCCTGCTGCTCTTTGTAGCCGATGCATCTCGCAACACTCAGCTGACTGACAAGGAGAGCGATGTGACTTACATCGTTGAGGGGTCTCGTGAAGGTAGTAACGAGGCTGCTGGTCTCAATGTTGTCATCCCCTCCAAACACGGCCTCCAAGATAAGTACTGCTGCCTGAAGGATGGTTTGGGATCATGTGTTCAGGAGTGCGACTCCAAGATCAAATACTACTGCTGCCTCAAGACTGGACTCGGCGGCTGCAAGCAACTCTGCGAGACCAATGTCGAATACTTCTGCTGCCTCAAGAACCCTTTTGGTACCTGCTTTCAGCTGTGCGACTCGTCCAAGGAACACTACTGCTGCAAGAAGAACGTTTCTGGTTCCTGCGTTGGAATGTGCCCCAAAACGGTGAACCTGATGAACTTGCCATGCCACTGCTGCTGGATCGTCCATTGGGAGACAAGTAGCTTTGAACAAGTCCTCATTCTAGTTCACGTCGCTCAGCACCAGGTCGCCATCGCTGGTAAAGCTGAGGAGGCAGGAAGGGGTGCTAAAGCCAAGGCTAATTCGAAATATCTGGAGTGGATTCGAGAGTGGAGCTTGGAGGAAGATGGCGCTTCCAGTGACATTGGAAGCTTTGTGTGGTCGACCAACACAGGAGGATCTGGAGCGCAAGTCTTGGCCCTCGAGAGCTCTGGAAATCTCGTCATCCGGAGCAAAATTGGAGATTTCCTGTGGCAGAGCTTTGATCATCCCTGTGATGCTGTGCTCCCTGGGATGAAGTTAGTAGCCAGCATCTCTAAGGAGAACAAAGAGCCAGGGTACTTCTCACTCGAGGTCTGGAGCTCCGATGAGGAAGAAGAAGAGATATCATTTCTCTTCCTCGTCAATAGCAGCTTGGAAATCCACGGGACGAAAGGTGTTATGTGGTCCACTCCAACGATCGGTGGTGTTACTGATCAATCAGGGCACCAGTTCCTCAAGATCTACTCGAATGGAGAGCCCCGGTTTACCTCGAGATCATTCAGCACCGGCAACAGCACGAAGAGCATCAACTTAAACCCGCTCTTCTTTGGGAAAAGCTCGCTTACTCGAACCTGTGGGATCTCGTTCGAGACAGCTGAAGGATACCTCTGCATCGTTCACGAAGTACGTTTCTTCCGGGGACAAGGAGGGATGCAAGCACCTGGAAGAACCTGCGAGAACTCGCAACATCACTACATGCTCGAAGCCACAGCAAAGCCAGCCATCGTCGCGGTTTTCTCTGTGGCGACCATGGCTATAATCATCATCGCAATGGTGACCTGGAAGAAACAGATAAACTCGTACCTCAAACACTACAAACCATCGTTGGTGCGCGTCTTTAATTACCCGGAGCTCCTCACTGCAACCAAAGCCTTCAGTGCGAAAATCGCAAGTGGAGGCGTTGGCACGGTTTTCGAAGGGATACTCTCCGTTGCCGTGAAACGGCTGGAGAGCTTCTCGAGCCAAGGATACAAACAGTTCAAGGCGGAGGAATCACACTACTTCCTGGTTTACGAGTACGTAGCAAACGGGTACAAGCCGCGGGAAGACACGAGATTCAAGATAGTCGAGGAGATTGCTCGAGGGATGTGCTACCTCCACGAGGAATGCAGCACTAGAGTTCTGCACTTGGACATCAAGCCGCAAAACCTACTCCTGGACGAAAACTTTGGTGTCAAGATAGCAGAGTTTGGACTGTCGAGGATGATGCGAGTGAGAGACAAACTGGACATCTACAGCTTTGGGATCCTTGTGCTGGAAGTGGCGCTTTCCATACCTGTGTGTCTTGCGGGAGGAGCCCAAAGTTCCTGGCGGTTTGAGAAGCTTCGGTCTGGGAAGTTAATGGAGATGTTAGAAGAGAAGAGGGCGCGGCAAGAAATGGAGGCTACCTCTAAGGCCGAGAAGCTGCTTCGCATTGGAGTGTGGTGCATCCAACCGGATTCTCAGCCAAATTGTGGGAATCCACTGACACTCATAGATTTTGTATGA


Protein sequences

Name Description Sequence
438187 S-domain-2 5 (best arabidopsis hit)

MAKVFLLSALLVGLLLFVADASRNTQLTDKESDVTYIVEGSREGSNEAAGLNVVIPSKHGLQDKYCCLKDGLGSCVQECDSKIKYYCCLKTGLGGCKQLCETNVEYFCCLKNPFGTCFQLCDSSKEHYCCKKNVSGSCVGMCPKTVNLMNLPCHCCWIVHWETSSFEQVLILVHVAQHQVAIAGKAEEAGRGAKAKANSKYLEWIREWSLEEDGASSDIGSFVWSTNTGGSGAQVLALESSGNLVIRSKIGDFLWQSFDHPCDAVLPGMKLVASISKENKEPGYFSLEVWSSDEEEEEISFLFLVNSSLEIHGTKGVMWSTPTIGGVTDQSGHQFLKIYSNGEPRFTSRSFSTGNSTKSINLNPLFFGKSSLTRTCGISFETAEGYLCIVHEVRFFRGQGGMQAPGRTCENSQHHYMLEATAKPAIVAVFSVATMAIIIIAMVTWKKQINSYLKHYKPSLVRVFNYPELLTATKAFSAKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLVYEYVANGYKPREDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVALSIPVCLAGGAQSSWRFEKLRSGKLMEMLEEKRARQEMEATSKAEKLLRIGVWCIQPDSQPNCGNPLTLIDFV*

Domains

Domain Start-End Description Sequence

HMMSmart: SM00108
IPR001480
160-261 B_lectin
Bulb-type lectin domain

HWETSSFEQVLILVHVAQHQVAIAGKAEEAGRGAKAKANSKYLEWIREWSLEEDGASSDIGSFVWSTNTGGSGAQVLALESSGNLVIRSKIGDFLWQSFDHP

HMMPanther: PTHR24420
205-662 PTHR24420,FAMILY NOT NAMED

IREWSLEEDGASSDIGSFVWSTNTGGSGAQVLALESSGNLVIRSKIGDFLWQSFDHPCDAVLPGMKLVASISKENKEPGYFSLEVWSSDEEEEEISFLFLVNSSLEIHGTKGVMWSTPTIGGVTDQSGHQFLKIYSNGEPRFTSRSFSTGNSTKSINLNPLFFGKSSLTRTCGISFETAEGYLCIVHEVRFFRGQGGMQAPGRTCENSQHHYMLEATAKPAIVAVFSVATMAIIIIAMVTWKKQINSYLKHYKPSLVRVFNYPELLTATKAFSAKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLVYEYVANGYKPREDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVALSIPVCLAGGAQSSWRFEKLRSGKLMEMLEEKRARQEMEATSKAEKLLRIGVWCIQ

HMMPanther: PTHR24420:SF442
205-662 PTHR24420:SF442,SUBFAMILY NOT NAMED

IREWSLEEDGASSDIGSFVWSTNTGGSGAQVLALESSGNLVIRSKIGDFLWQSFDHPCDAVLPGMKLVASISKENKEPGYFSLEVWSSDEEEEEISFLFLVNSSLEIHGTKGVMWSTPTIGGVTDQSGHQFLKIYSNGEPRFTSRSFSTGNSTKSINLNPLFFGKSSLTRTCGISFETAEGYLCIVHEVRFFRGQGGMQAPGRTCENSQHHYMLEATAKPAIVAVFSVATMAIIIIAMVTWKKQINSYLKHYKPSLVRVFNYPELLTATKAFSAKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLVYEYVANGYKPREDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVALSIPVCLAGGAQSSWRFEKLRSGKLMEMLEEKRARQEMEATSKAEKLLRIGVWCIQ

HMMPfam: PF01453
IPR001480
220-274 B_lectin
Bulb-type lectin domain

GSFVWSTNTGGSGAQVLALESSGNLVIRSKIGDFLWQSFDHPCDAVLPGMKLVAS

Gene3D: G3DSA:2.90.10.10
IPR001480
220-263 Bulb-type_lectin_dom
Bulb-type lectin domain

GSFVWSTNTGGSGAQVLALESSGNLVIRSKIGDFLWQSFDHPCD

superfamily: SSF51110
IPR001480
220-321 B_lectin
Bulb-type lectin domain

GSFVWSTNTGGSGAQVLALESSGNLVIRSKIGDFLWQSFDHPCDAVLPGMKLVASISKENKEPGYFSLEVWSSDEEEEEISFLFLVNSSLEIHGTKGVMWST

Gene3D: G3DSA:2.90.10.10
IPR001480
297-324 Bulb-type_lectin_dom
Bulb-type lectin domain

EEISFLFLVNSSLEIHGTKGVMWSTPTI

ProfileScan: PS50011
IPR000719
391-679 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

HEVRFFRGQGGMQAPGRTCENSQHHYMLEATAKPAIVAVFSVATMAIIIIAMVTWKKQINSYLKHYKPSLVRVFNYPELLTATKAFSAKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLVYEYVANGYKPREDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVALSIPVCLAGGAQSSWRFEKLRSGKLMEMLEEKRARQEMEATSKAEKLLRIGVWCIQPDSQPNCGNPLTLIDFV

superfamily: SSF56112
IPR011009
446-664 Kinase_like
Protein kinase-like domain

KKQINSYLKHYKPSLVRVFNYPELLTATKAFSAKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAEESHYFLVYEYVANGYKPREDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVRDKLDIYSFGILVLEVALSIPVCLAGGAQSSWRFEKLRSGKLMEMLEEKRARQEMEATSKAEKLLRIGVWCIQPD

Gene3D: G3DSA:3.30.200.20
457-514 G3DSA:3.30.200.20

KPSLVRVFNYPELLTATKAFSAKIASGGVGTVFEGILSVAVKRLESFSSQGYKQFKAE

HMMPfam: PF00069
IPR000719
515-587 Pkinase,Ser-thr
Protein kinase, catalytic domain

ESHYFLVYEYVANGYKPREDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMM

Gene3D: G3DSA:1.10.510.10
522-590 G3DSA:1.10.510.10

YEYVANGYKPREDTRFKIVEEIARGMCYLHEECSTRVLHLDIKPQNLLLDENFGVKIAEFGLSRMMRVR

PatternScan: PS00108
IPR008271
558-570 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHLDIKPQNLLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox