PRGDB00182527 (231705)

From PRG Wiki
Jump to: navigation, search
231705
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Protein kinase superfamily protein (best arabidopsis hit)

DNA Sequence

ATGTCGTGCTTAAGCTGCTGTGGTACTTTTCCTGGCAGGAACGAAGATCACGATCGCCACCATAGCCACTCACAAACGGCTCATGGGAATTTAAGAGATCATGTAGCTCCTAATACTTGGCAAGGTCGGGTACAACCCATTGCTGTGTCGCCAATCCCAGTCGAGGAGGTGTTGGAGAGCACCGAGAATTTCGACCAGAGCCGTCTCATTGGAGAGGGCTCGTATGGTCGAGTTTATCTTGCAAAGCTGCGCAATGGGCAGTCCGTGGCTCTCAAGAAGCTCGATTCGAGCCCGCAACCGCATGAGGACTTCGTCTCTCAGGTGTCAAGGCAGTCGAGGCTCAAACACGAGAATATGGTGGAGCTCCTTGGATACTGCATTGACGGCCCTCTGCGTGTTCTCGCGTTTGAGTTCGCGGAGATGGGATCTCTCCATGATATTCTTCACGGCAGGAAAGGTGTGCTTGGATCGAGGCCAGGGCCTGTGCTGGACTGGATGCAAAGAGTAAAGATTGCGGTTGGAGCGGCCAGAGGGCTAGAGTATTTGCACGAGAAGGCCCAGCCACCAGTCGTCCACCGAGACATCAAGTCGAGCAACGTCTTGCTGTTCGAGAACTACGCAGCTAAGATTGGAGACTACAACCCGAGCAACCAGGCACCGGACATGGCTTCACGGCTGCATTCGACTCGGGTTCTGGGATCATTCGGCTACCACGCACCAGAGTATGCGATGACCGGGCAATTAACTCAGAAGAGCGATGTCTACAGCTTTGGAGTTGTTCTTCTGGAGCTTCTCACGGGAAGGAGGCCAGTTGATCCTTCAATGCCTCGGGGCCAGCAAAGTCTGGTGACATGGGCAACGCCGAGGCTGACCGAAGACAAAGTGACGCAGTGCGCGGATCCAAATCTCAAGGGAGAGTACCCTCCTAAAGGCCTGGCCAAATTTGCTGCAGTTGCTGCCTTGTGTGTCCAATACGAAGCCGACTTCCGGCCAAGCATGAGCATTGTGGTCAAGGCTCTCCAGCCACTTCTAGGCCCTCGCACCGCTCCACCACCTTCGCTTGCTCTAGACGACACTCTCAATCGTTTCGTCTAA


Protein sequences

Name Description Sequence
231705 Protein kinase superfamily protein (best arabidopsis hit)

MSCLSCCGTFPGRNEDHDRHHSHSQTAHGNLRDHVAPNTWQGRVQPIAVSPIPVEEVLESTENFDQSRLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQPHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEADFRPSMSIVVKALQPLLGPRTAPPPSLALDDTLNRFV*

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
34-340 Kinase_like
Protein kinase-like domain

HVAPNTWQGRVQPIAVSPIPVEEVLESTENFDQSRLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQPHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEADFRPSMSIVVKAL

HMMPanther: PTHR24420
45-355 PTHR24420,FAMILY NOT NAMED

QPIAVSPIPVEEVLESTENFDQSRLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQPHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEADFRPSMSIVVKALQPLLGPRTAPPPSLA

HMMPanther: PTHR24420:SF416
45-355 PTHR24420:SF416,SUBFAMILY NOT NAMED

QPIAVSPIPVEEVLESTENFDQSRLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQPHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEADFRPSMSIVVKALQPLLGPRTAPPPSLA

Gene3D: G3DSA:3.30.200.20
50-138 G3DSA:3.30.200.20

SPIPVEEVLESTENFDQSRLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQPHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEF

ProfileScan: PS50011
IPR000719
64-344 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDQSRLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQPHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEADFRPSMSIVVKALQPLL

HMMPfam: PF07714
IPR001245
67-340 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SRLIGEGSYGRVYLAKLRNGQSVALKKLDSSPQPHEDFVSQVSRQSRLKHENMVELLGYCIDGPLRVLAFEFAEMGSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEADFRPSMSIVVKAL

PatternScan: PS00107
IPR017441
70-92 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGEGSYGRVYLAKLRNGQSVALK

Gene3D: G3DSA:1.10.510.10
142-339 G3DSA:1.10.510.10

GSLHDILHGRKGVLGSRPGPVLDWMQRVKIAVGAARGLEYLHEKAQPPVVHRDIKSSNVLLFENYAAKIGDYNPSNQAPDMASRLHSTRVLGSFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRRPVDPSMPRGQQSLVTWATPRLTEDKVTQCADPNLKGEYPPKGLAKFAAVAALCVQYEADFRPSMSIVVKA

PatternScan: PS00108
IPR008271
190-202 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDIKSSNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox