PRGDB00182528 (444789)

From PRG Wiki
Jump to: navigation, search
444789
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

ACT-like protein tyrosine kinase family protein (best arabidopsis hit)

DNA Sequence

ATGACCTCGTCGCAAGAGTTCTTGGAGGAGGAGGCGGTGGCGGTGGAGGGAAATATCCAGGAGGAGCTGCGCCACCGGTCTCACGGTAGCGGCGGGGGAGAGGAAGCTTTTTCACTGCATCGGGCCACAAAGGCCGAGGTGTGCCAGGAGATTGTCAAGCGGCTCCAGGCGCAGAATCACGAGGCTTTGGAGGATCCCGGATTTCTGGAAGAGCTACAGGCACATTTCAATCGCTTGCCGACGAGGTATGCGTTGGATGTCAACACGGAGAGGGCTGAGGACGTGCTCATGCACAAGCGATTGCTGCAGCTCGCGGAGAATCCCGACATCAGGCCCGTCTTTCACGTCCGGATCGTCCAAGTCCAGCAGCGCTTGGACGAATCAGTACCAGGAGACCAGTGCATGCCCGTGCCTGAAACTCAGCTTGTACATCCACCTCCTGCATTTGGTTCTTCTCCTAACCTCGAAGCTTTAGTCCTCGATCTGAATAAGCCTTCATCTGATGAAGATCGAGAGAGTCATGCGGATAATTCCCCAAGCCGTGGACTCGCTCAGATCTTTATGCACGAAGTGACGATATCAACTATAGATAAACCCAAGCTTTTAAGCCAGCTATCGGCTTGGCTTGCCGACGTTGGATTGAATATCCAAGAAGCGCACGCTTTCTCCACTAGAGATGGGTTTTCTCTCGATGTCTTCGTAGTGGACGGCTGGTCATGTGAGGATACGGATGGCCTACAGTTGGCAATGGAGCGAGCATTGGCTGGCATTGAGAAAGAGGCGTGGACCAAGCCGAAATCTCCCACCAAAAGTCTTTCAAATGGCCGCAGGCACGGTCATGTAAAGATTCCTTTTGATGGCAAGGATGATTGGGAGATCGATAGTGAGCAGTTGAAACTGCTGCATAAGGTGGCTTCTGGCTCCTTCGGTGATCTTTTCCGAGGAGTGTACTGCGGGCAAGATGTTGCAATTAAAGTGTTGAAACCCGAGCGTTTGAACGAAGATTTACAAAAGGAATTTGCTCAAGAAGTCTTCATCATGCGGAAAGTGCGCCACAAAAACGTTGTGCAGTTTATAGGAGCATGCACTAAGCCGCCGAACTTATCTATAGTCACTGAGTACATGTCCGGTGGAAGTGTTTACGATTATTTGCACAAGCATCGATCCGTTTTAAAACTACCGATGGCACTCAGAGTGGCTATTGACGTGTCAAAAGGAATGGATTATCTGCACCAGAACAACATAGTTCACCGGGATTTGAAAGCGGCAAACTTGTTAATGGACGAGAACGAGGTTGTCAAAGTAGCTGATTTTGGAGTTGCAAGAGTGAAGGACCACACTGGTGTGATGACTGCTGAAACGGGAACTTATCGTTGGATGGCACCAGAGGTTATCGAGCATAAGCCATATGACCACAAGGCTGACATCTTTAGTTTTGGCGTAGTTTTATGGGAGCTTTTGACGGGCAAGCTGCCTTACGACTATCTCACACCGTTACAAGCGGCTGTTGCAGTCGTTCAGAAGGGGCTTCGACCTGTTATTCCGAAAAACACTCATCCCAAGCTTGCTGAATTGATGGAGAAATGCTGGCAATCAAACGCTGCAGAGAGGCCGGAGTTTTCAATAATTACTCTAGTTTTGCAAGACGTGTATAAAGAGATTGGAGAGGAAGAAAGCGAGAAGAAGAAAAAGTCTGGAATCTTTTCAGCTTTCCGGCGGAACCTGTGA


Protein sequences

Name Description Sequence
444789 ACT-like protein tyrosine kinase family protein (best arabidopsis hit)

MTSSQEFLEEEAVAVEGNIQEELRHRSHGSGGGEEAFSLHRATKAEVCQEIVKRLQAQNHEALEDPGFLEELQAHFNRLPTRYALDVNTERAEDVLMHKRLLQLAENPDIRPVFHVRIVQVQQRLDESVPGDQCMPVPETQLVHPPPAFGSSPNLEALVLDLNKPSSDEDRESHADNSPSRGLAQIFMHEVTISTIDKPKLLSQLSAWLADVGLNIQEAHAFSTRDGFSLDVFVVDGWSCEDTDGLQLAMERALAGIEKEAWTKPKSPTKSLSNGRRHGHVKIPFDGKDDWEIDSEQLKLLHKVASGSFGDLFRGVYCGQDVAIKVLKPERLNEDLQKEFAQEVFIMRKVRHKNVVQFIGACTKPPNLSIVTEYMSGGSVYDYLHKHRSVLKLPMALRVAIDVSKGMDYLHQNNIVHRDLKAANLLMDENEVVKVADFGVARVKDHTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVVLWELLTGKLPYDYLTPLQAAVAVVQKGLRPVIPKNTHPKLAELMEKCWQSNAAERPEFSIITLVLQDVYKEIGEEESEKKKKSGIFSAFRRNL*

Domains

Domain Start-End Description Sequence

superfamily: SSF55021
189-271 SSF55021

HEVTISTIDKPKLLSQLSAWLADVGLNIQEAHAFSTRDGFSLDVFVVDGWSCEDTDGLQLAMERALAGIEKEAWTKPKSPTKS

HMMPfam: PF01842
IPR002912
189-236 ACT
Amino acid-binding ACT

HEVTISTIDKPKLLSQLSAWLADVGLNIQEAHAFSTRDGFSLDVFVVD

Gene3D: G3DSA:3.30.70.260
191-253 G3DSA:3.30.70.260

VTISTIDKPKLLSQLSAWLADVGLNIQEAHAFSTRDGFSLDVFVVDGWSCEDTDGLQLAMERA

superfamily: SSF56112
IPR011009
270-547 Kinase_like
Protein kinase-like domain

KSLSNGRRHGHVKIPFDGKDDWEIDSEQLKLLHKVASGSFGDLFRGVYCGQDVAIKVLKPERLNEDLQKEFAQEVFIMRKVRHKNVVQFIGACTKPPNLSIVTEYMSGGSVYDYLHKHRSVLKLPMALRVAIDVSKGMDYLHQNNIVHRDLKAANLLMDENEVVKVADFGVARVKDHTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVVLWELLTGKLPYDYLTPLQAAVAVVQKGLRPVIPKNTHPKLAELMEKCWQSNAAERPEFSIITLVL

HMMPanther: PTHR23257:SF82
277-564 ATMRK_like,Ser-thr,PROTEIN KINASE ATMRK1

RHGHVKIPFDGKDDWEIDSEQLKLLHKVASGSFGDLFRGVYCGQDVAIKVLKPERLNEDLQKEFAQEVFIMRKVRHKNVVQFIGACTKPPNLSIVTEYMSGGSVYDYLHKHRSVLKLPMALRVAIDVSKGMDYLHQNNIVHRDLKAANLLMDENEVVKVADFGVARVKDHTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVVLWELLTGKLPYDYLTPLQAAVAVVQKGLRPVIPKNTHPKLAELMEKCWQSNAAERPEFSIITLVLQDVYKEIGEEESEKKKK

HMMPanther: PTHR23257
277-564 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

RHGHVKIPFDGKDDWEIDSEQLKLLHKVASGSFGDLFRGVYCGQDVAIKVLKPERLNEDLQKEFAQEVFIMRKVRHKNVVQFIGACTKPPNLSIVTEYMSGGSVYDYLHKHRSVLKLPMALRVAIDVSKGMDYLHQNNIVHRDLKAANLLMDENEVVKVADFGVARVKDHTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVVLWELLTGKLPYDYLTPLQAAVAVVQKGLRPVIPKNTHPKLAELMEKCWQSNAAERPEFSIITLVLQDVYKEIGEEESEKKKK

Gene3D: G3DSA:3.30.200.20
289-360 G3DSA:3.30.200.20

DDWEIDSEQLKLLHKVASGSFGDLFRGVYCGQDVAIKVLKPERLNEDLQKEFAQEVFIMRKVRHKNVVQFIG

HMMSmart: SM00220
IPR002290
298-552 S_TKc
Serine/threonine- / dual-specificity protein kinas

LKLLHKVASGSFGDLFRGVYCGQDVAIKVLKPERLNEDLQKEFAQEVFIMRKVRHKNVVQFIGACTKPPNLSIVTEYMSGGSVYDYLHKHRSVLKLPMALRVAIDVSKGMDYLHQNNIVHRDLKAANLLMDENEVVKVADFGVARVKDHTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVVLWELLTGKLPYDYLTPLQAAVAVVQKGLRPVIPKNTHPKLAELMEKCWQSNAAERPEFSIITLVLQDVYK

HMMPfam: PF07714
IPR001245
298-544 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

LKLLHKVASGSFGDLFRGVYCGQDVAIKVLKPERLNEDLQKEFAQEVFIMRKVRHKNVVQFIGACTKPPNLSIVTEYMSGGSVYDYLHKHRSVLKLPMALRVAIDVSKGMDYLHQNNIVHRDLKAANLLMDENEVVKVADFGVARVKDHTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVVLWELLTGKLPYDYLTPLQAAVAVVQKGLRPVIPKNTHPKLAELMEKCWQSNAAERPEFSIIT

ProfileScan: PS50011
IPR000719
298-551 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LKLLHKVASGSFGDLFRGVYCGQDVAIKVLKPERLNEDLQKEFAQEVFIMRKVRHKNVVQFIGACTKPPNLSIVTEYMSGGSVYDYLHKHRSVLKLPMALRVAIDVSKGMDYLHQNNIVHRDLKAANLLMDENEVVKVADFGVARVKDHTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVVLWELLTGKLPYDYLTPLQAAVAVVQKGLRPVIPKNTHPKLAELMEKCWQSNAAERPEFSIITLVLQDVY

Gene3D: G3DSA:1.10.510.10
361-551 G3DSA:1.10.510.10

ACTKPPNLSIVTEYMSGGSVYDYLHKHRSVLKLPMALRVAIDVSKGMDYLHQNNIVHRDLKAANLLMDENEVVKVADFGVARVKDHTGVMTAETGTYRWMAPEVIEHKPYDHKADIFSFGVVLWELLTGKLPYDYLTPLQAAVAVVQKGLRPVIPKNTHPKLAELMEKCWQSNAAERPEFSIITLVLQDVY

FPrintScan: PR00109
IPR001245
372-385 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

TEYMSGGSVYDYLH

FPrintScan: PR00109
IPR001245
409-427 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

YLHQNNIVHRDLKAANLLM

PatternScan: PS00108
IPR008271
415-427 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKAANLLM

FPrintScan: PR00109
IPR001245
455-465 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

GTYRWMAPEVI

FPrintScan: PR00109
IPR001245
474-496 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

ADIFSFGVVLWELLTGKLPYDYL

FPrintScan: PR00109
IPR001245
518-540 TYRKINASE
Serine-threonine/tyrosine-protein kinase catalytic

THPKLAELMEKCWQSNAAERPEF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox