PRGDB00182588 (107497)

From PRG Wiki
Jump to: navigation, search
107497
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Selaginella moellendorffii

Comment?

Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

DNA Sequence

GGCCGCGCCACTTCACTGTCGCTCCAGCAAGAAATGCAAGCGCTGCTGTCCTTCAAGGCCTCGATCGTCGCGCACAACCCCGGGAAGAGCTCGATCCTCGATGGCTGGAACCCTAGCGATGGCGATCCCTGCAAGTGGGGTGGGATCCAGTGCAGCCAGGGGCCCGAGGGCGTCCACGTCACAGCCATCGATCTCTCCTCCAACAATCTCGCCGGATCCATCCCCGAGGGCCTCGCCAATCTCTCCTACCTCTCCTCGCTCTCCCTCGCGCTCAATTCCTTCTCCGGCCGCCTCCCAGGCGATCTCTCCCGCTGCTCCAGCCTCGCCGAGCTCGATCTCTCCAGCAACCAGCTCCACGACACGATCCCGCCATCGCTCCTGGACGAGCTGCCCTCTCTCGCCACCATCAATCTCGCCTACAACGATCTCGTGGGCGGGATCCCCGACGAGTTCTTCTCGCCCAGATCGTGCGCCAATCTCCAGGCGCTCAATCTCTCCAGCAATCCCGGCCTGGGCGGGCCCCTGCCGGGATCTCTCAAGAACTGCCGCGCGATCGAGCTCCTCGACGTCTCAAGCTGCAATCTCACAGGATCACTCCCAGACGACACGATCGCGAGGCTGCCGCTCCTCTCCAATCTCGTCCTCCGCGAGAATGGATTCGTGGGCGAGGTCTCGCCGGAGTTCTTCTCCAGCTGCCAGAACCTCGAGAGCCTGGATCTGGCGCTCAACAATCTCACTGGAGACATCCCCGCCCAGATCGAGAACTGCAGCAAGCTCGTCAATCTCGCCGTCTCGGCGAACAGTTTCCACTCCCTGCCGCGGGAGATCGGCGGGCTATCGGCGCTGGAGCGCCTCCTCGCGACGCACAACGGGTTCACGGAGCTCCCCGCGGAGCTGGAGCGGTGTTCCAAGATTAGGGTTCTTGCGGTGAGTGGGAATTCTCTCTCGGGGCCACTGCCTGGATTCATCGCCAAGTTCTCGAGCCTGGAATTCCTGAGCGTCTACACCAATCGCTTCGTGGGCGCCGTCCCGGCGTGGCTGGGCGGGCTGCGATCGCTGCGGCACCTCGACGCCAGCAACAATTTGTTCACGGGCGAGATCCCGGTGGAAATCTCCGGCGCCAGCGAGCTCCAGTTCTTGCTCCTGGCAGGGAACGCGCTCAGCGGCGAGATCCCTCGCGAGATCGGCAGCAAGCTCCTCAATCTCCAGGTGCTGGATCTCTCCCACAACCAAATCTCGGGCAGGATCCCTCCATCGCTGGGCAACCTCAAGTTCTTGCTGTGGCTGATGCTCGCGAGCAACGATCTGGAGGGCGAGATCCCGGCGGAGCTGGGGAATTGCAGCAGCCTCCTGTGGCTCAACGCGGCCAGCAATCGCTTGTCGGGATCGCTGCCGGAATCCATCGCCTCCATCGGGAGTGGCGTCAATGCGACCTTCGCGCTCAACGCAAGAACCCTACCGCTCATCCCCAAGGGCATGGGCGAGTGCGAAGCGGTCAGGCGCTGGATCCCCTCCCAGTACCCTCCCTTCGATCTCATCTCCACGGTCATGACGGTCGAGCGCTGCCGGAGCTTCTGGAATTTGCTCCTCCGCGGGATCTTCATGTATCCTCTCTGCCCCAGCCGCCCATCCGAGGAATCCATGGGCTACATCCAGCTCGCGAGCAATCGACTGACAGGACCCATCCCAGGGACGCTGGATCGCTGCCGGCATTTGGGGCTCCTCTTCCTGGATCAAAACAACCTCACTGGATCCATGCCCCAGAGCTACTCCATCGCGCTCACGGGGCTCAATGTCTCGCGCAACGCCCTCTCCGGATCGGTGCCGCGATCGATCGGCGCGCTCTCCTGCGTGGTGAGCCTGGACCTCAGCTACAACAATCTCAGCGGGAGGATCCCCAGCGAGCTCCAGAACCTCTCCAAGCTCAATCGATTCAACATCTCCTACAATCCAGAGCTCGTCGGCCCAGTCCCAAGCGGTCAGCAATTCTCCACCTTCGGCCCCAGCGTCTACGAGGGCGATCTCAAGCTGTGCTCCTCCTCGTCCAGCGTCATGGGGATGAAGAACCCTAATTCTTCCCTCCCATCTTGCGGGAAGCTCGGCGATGGCGGCGGCGATGGCGATGGAGGCGGCGGCGGGGGCGGATTCCTCCCGCGGAGCTCGCGGATCGCGGTGGCGACGGTGGTGGGGATCAGCCTGGCGTGCACGCTGGGGCTGATCGTGCTCGCACTGCTAGGGTTTTGCCTCCTGGGCAAGGCGGCGCCGCCCGGGCCCGGTGGCGCCGCCATGGACTTCGTCATGGTGGGCGGCAAGGAGCACCACCGCCACTTCGCGCCGGATCACGCCGCCGCCGCCAGCGTCCAGGTATCGCTCTTCTCGGTGGAGCTCCCCAAGCACCTCACGTACTCGGACCTCGTCTCCGCGACGAGCAATTTCGACGAGACGAATGTGGTGGGCAGCGGTGGATTCGGCATCGTCTACAAGGCCAAGCTCGCGGATGGATCCACCGTCGCGATCAAGAAGCTCATCCAGGAGGGTCCCCAGGCCGATCGCGAGTTCCTGGCGGAGATGGAGACGCTGGGTCACCTGCACCACGAGAACCTCGTCCCGCTGCTCGGCTGCTCCAGCTATGGCACCCAGAAGCTCCTCGTCTACAAGTACATGGAGAAGGGATCGCTGGACGACTGGCTCCACGAGAAGCCCGGAGGAGCGCAAGCGCTAGAGTGGCCGATCCGGCTCAACATCGCACTGGGGATCGCGAGAGGATTGAAGTTCCTCCACCACAATTGCTCGCCGCCGATCGTCCACCGCGACATGAAAGCTAGCAACATCCTCCTGGACGACAACTTCGAGCCGCGGCTCACGGACTTTGGGCTGGCCAGAGTTCTCGGAGCGCAAGAGACGCACGTAAGCACGGTGGTGGCCGGGACGCTGGGCTACGTACCGCCGGAGTACTGCCAGACGTGGAGGGCTACCGCGCGGGGCGACGTTTACAGCTTTGGCGTGGTGCTGCTCGAGCTCGTCACCGGGAGGAGGCCCATGTCCATCTCGTTTGGAGGCGAGAACAAGGATCACGGGTGTGGGAACTTGATCGAGTGGTCGGCTTACCACGTGAAGAAGGGGATCGCGGCGGAGGTTTGCGACCGGATCGTGCTGCGCTCGGCGGCTCCCGGGGAGCTGCTGGCGTTCCTGCGGCTGGCGGTGGTGTGTACCGCGGAGCTGCCCATCCGGCGGCCGACGATGCGGGAGGTGCTCAAGGTTTTGGAGGAGATCAAGGCGGGGAACTACGCAGCGATGCTGCAGGGATCATCGCAGGGGGGTCACCAGTTTCGGTGA


Protein sequences

Name Description Sequence
107497 Leucine-rich repeat protein kinase family protein (best arabidopsis hit)

GRATSLSLQQEMQALLSFKASIVAHNPGKSSILDGWNPSDGDPCKWGGIQCSQGPEGVHVTAIDLSSNNLAGSIPEGLANLSYLSSLSLALNSFSGRLPGDLSRCSSLAELDLSSNQLHDTIPPSLLDELPSLATINLAYNDLVGGIPDEFFSPRSCANLQALNLSSNPGLGGPLPGSLKNCRAIELLDVSSCNLTGSLPDDTIARLPLLSNLVLRENGFVGEVSPEFFSSCQNLESLDLALNNLTGDIPAQIENCSKLVNLAVSANSFHSLPREIGGLSALERLLATHNGFTELPAELERCSKIRVLAVSGNSLSGPLPGFIAKFSSLEFLSVYTNRFVGAVPAWLGGLRSLRHLDASNNLFTGEIPVEISGASELQFLLLAGNALSGEIPREIGSKLLNLQVLDLSHNQISGRIPPSLGNLKFLLWLMLASNDLEGEIPAELGNCSSLLWLNAASNRLSGSLPESIASIGSGVNATFALNARTLPLIPKGMGECEAVRRWIPSQYPPFDLISTVMTVERCRSFWNLLLRGIFMYPLCPSRPSEESMGYIQLASNRLTGPIPGTLDRCRHLGLLFLDQNNLTGSMPQSYSIALTGLNVSRNALSGSVPRSIGALSCVVSLDLSYNNLSGRIPSELQNLSKLNRFNISYNPELVGPVPSGQQFSTFGPSVYEGDLKLCSSSSSVMGMKNPNSSLPSCGKLGDGGGDGDGGGGGGGFLPRSSRIAVATVVGISLACTLGLIVLALLGFCLLGKAAPPGPGGAAMDFVMVGGKEHHRHFAPDHAAAASVQVSLFSVELPKHLTYSDLVSATSNFDETNVVGSGGFGIVYKAKLADGSTVAIKKLIQEGPQADREFLAEMETLGHLHHENLVPLLGCSSYGTQKLLVYKYMEKGSLDDWLHEKPGGAQALEWPIRLNIALGIARGLKFLHHNCSPPIVHRDMKASNILLDDNFEPRLTDFGLARVLGAQETHVSTVVAGTLGYVPPEYCQTWRATARGDVYSFGVVLLELVTGRRPMSISFGGENKDHGCGNLIEWSAYHVKKGIAAEVCDRIVLRSAAPGELLAFLRLAVVCTAELPIRRPTMREVLKVLEEIKAGNYAAMLQGSSQGGHQFR*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
3-1091 PTHR24420,FAMILY NOT NAMED

ATSLSLQQEMQALLSFKASIVAHNPGKSSILDGWNPSDGDPCKWGGIQCSQGPEGVHVTAIDLSSNNLAGSIPEGLANLSYLSSLSLALNSFSGRLPGDLSRCSSLAELDLSSNQLHDTIPPSLLDELPSLATINLAYNDLVGGIPDEFFSPRSCANLQALNLSSNPGLGGPLPGSLKNCRAIELLDVSSCNLTGSLPDDTIARLPLLSNLVLRENGFVGEVSPEFFSSCQNLESLDLALNNLTGDIPAQIENCSKLVNLAVSANSFHSLPREIGGLSALERLLATHNGFTELPAELERCSKIRVLAVSGNSLSGPLPGFIAKFSSLEFLSVYTNRFVGAVPAWLGGLRSLRHLDASNNLFTGEIPVEISGASELQFLLLAGNALSGEIPREIGSKLLNLQVLDLSHNQISGRIPPSLGNLKFLLWLMLASNDLEGEIPAELGNCSSLLWLNAASNRLSGSLPESIASIGSGVNATFALNARTLPLIPKGMGECEAVRRWIPSQYPPFDLISTVMTVERCRSFWNLLLRGIFMYPLCPSRPSEESMGYIQLASNRLTGPIPGTLDRCRHLGLLFLDQNNLTGSMPQSYSIALTGLNVSRNALSGSVPRSIGALSCVVSLDLSYNNLSGRIPSELQNLSKLNRFNISYNPELVGPVPSGQQFSTFGPSVYEGDLKLCSSSSSVMGMKNPNSSLPSCGKLGDGGGDGDGGGGGGGFLPRSSRIAVATVVGISLACTLGLIVLALLGFCLLGKAAPPGPGGAAMDFVMVGGKEHHRHFAPDHAAAASVQVSLFSVELPKHLTYSDLVSATSNFDETNVVGSGGFGIVYKAKLADGSTVAIKKLIQEGPQADREFLAEMETLGHLHHENLVPLLGCSSYGTQKLLVYKYMEKGSLDDWLHEKPGGAQALEWPIRLNIALGIARGLKFLHHNCSPPIVHRDMKASNILLDDNFEPRLTDFGLARVLGAQETHVSTVVAGTLGYVPPEYCQTWRATARGDVYSFGVVLLELVTGRRPMSISFGGENKDHGCGNLIEWSAYHVKKGIAAEVCDRIVLRSAAPGELLAFLRLAVVCTAELPIRRPTMREVLKVLEEI

superfamily: SSF52058
5-223 SSF52058,LRR

SLSLQQEMQALLSFKASIVAHNPGKSSILDGWNPSDGDPCKWGGIQCSQGPEGVHVTAIDLSSNNLAGSIPEGLANLSYLSSLSLALNSFSGRLPGDLSRCSSLAELDLSSNQLHDTIPPSLLDELPSLATINLAYNDLVGGIPDEFFSPRSCANLQALNLSSNPGLGGPLPGSLKNCRAIELLDVSSCNLTGSLPDDTIARLPLLSNLVLRENGFVGE

Gene3D: G3DSA:3.80.10.10
9-276 G3DSA:3.80.10.10

QQEMQALLSFKASIVAHNPGKSSILDGWNPSDGDPCKWGGIQCSQGPEGVHVTAIDLSSNNLAGSIPEGLANLSYLSSLSLALNSFSGRLPGDLSRCSSLAELDLSSNQLHDTIPPSLLDELPSLATINLAYNDLVGGIPDEFFSPRSCANLQALNLSSNPGLGGPLPGSLKNCRAIELLDVSSCNLTGSLPDDTIARLPLLSNLVLRENGFVGEVSPEFFSSCQNLESLDLALNNLTGDIPAQIENCSKLVNLAVSANSFHSLPREI

HMMPfam: PF08263
IPR013210
9-52 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

QQEMQALLSFKASIVAHNPGKSSILDGWNPSDGDPCKWGGIQCS

ProfileScan: PS51450
IPR001611
59-82 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HVTAIDLSSNNLAGSIPEGLANLS

ProfileScan: PS51450
IPR001611
107-128 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLAELDLSSNQLHDTIPPSLLD

HMMPfam: PF00560
IPR001611
107-129 LRR_1
Leucine-rich repeat

SLAELDLSSNQLHDTIPPSLLDE

FPrintScan: PR00019
108-121 LEURICHRPT,Leucine-rich repeat signature

LAELDLSSNQLHDT

ProfileScan: PS51450
IPR001611
132-154 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLATINLAYNDLVGGIPDEFFSP

superfamily: SSF52058
157-465 SSF52058,LRR

CANLQALNLSSNPGLGGPLPGSLKNCRAIELLDVSSCNLTGSLPDDTIARLPLLSNLVLRENGFVGEVSPEFFSSCQNLESLDLALNNLTGDIPAQIENCSKLVNLAVSANSFHSLPREIGGLSALERLLATHNGFTELPAELERCSKIRVLAVSGNSLSGPLPGFIAKFSSLEFLSVYTNRFVGAVPAWLGGLRSLRHLDASNNLFTGEIPVEISGASELQFLLLAGNALSGEIPREIGSKLLNLQVLDLSHNQISGRIPPSLGNLKFLLWLMLASNDLEGEIPAELGNCSSLLWLNAASNRLSGSLP

ProfileScan: PS51450
IPR001611
159-180 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQALNLSSNPGLGGPLPGSLK

HMMPfam: PF00560
IPR001611
186-206 LRR_1
Leucine-rich repeat

ELLDVSSCNLTGSLPDDTIAR

HMMPfam: PF13855
208-268 LRR_8,Leucine rich repeat

PLLSNLVLRENGFVGEVSPEFFSSCQNLESLDLALNNLTGDIPAQIENCSKLVNLAVSANS

ProfileScan: PS51450
IPR001611
234-256 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLESLDLALNNLTGDIPAQIENC

Gene3D: G3DSA:3.80.10.10
277-470 G3DSA:3.80.10.10

GGLSALERLLATHNGFTELPAELERCSKIRVLAVSGNSLSGPLPGFIAKFSSLEFLSVYTNRFVGAVPAWLGGLRSLRHLDASNNLFTGEIPVEISGASELQFLLLAGNALSGEIPREIGSKLLNLQVLDLSHNQISGRIPPSLGNLKFLLWLMLASNDLEGEIPAELGNCSSLLWLNAASNRLSGSLPESIAS

ProfileScan: PS51450
IPR001611
281-303 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALERLLATHNGFTELPAELERCS

HMMPfam: PF00560
IPR001611
352-372 LRR_1
Leucine-rich repeat

SLRHLDASNNLFTGEIPVEIS

ProfileScan: PS51450
IPR001611
352-374 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRHLDASNNLFTGEIPVEISGA

ProfileScan: PS51450
IPR001611
376-398 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELQFLLLAGNALSGEIPREIGSK

superfamily: SSF52058
398-686 SSF52058,LRR

KLLNLQVLDLSHNQISGRIPPSLGNLKFLLWLMLASNDLEGEIPAELGNCSSLLWLNAASNRLSGSLPESIASIGSGVNATFALNARTLPLIPKGMGECEAVRRWIPSQYPPFDLISTVMTVERCRSFWNLLLRGIFMYPLCPSRPSEESMGYIQLASNRLTGPIPGTLDRCRHLGLLFLDQNNLTGSMPQSYSIALTGLNVSRNALSGSVPRSIGALSCVVSLDLSYNNLSGRIPSELQNLSKLNRFNISYNPELVGPVPSGQQFSTFGPSVYEGDLKLCSSSSSVMG

FPrintScan: PR00019
399-412 LEURICHRPT,Leucine-rich repeat signature

LLNLQVLDLSHNQI

HMMPfam: PF00560
IPR001611
401-423 LRR_1
Leucine-rich repeat

NLQVLDLSHNQISGRIPPSLGNL

ProfileScan: PS51450
IPR001611
401-424 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQVLDLSHNQISGRIPPSLGNLK

ProfileScan: PS51450
IPR001611
449-471 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLLWLNAASNRLSGSLPESIASI

Gene3D: G3DSA:3.80.10.10
547-657 G3DSA:3.80.10.10

SMGYIQLASNRLTGPIPGTLDRCRHLGLLFLDQNNLTGSMPQSYSIALTGLNVSRNALSGSVPRSIGALSCVVSLDLSYNNLSGRIPSELQNLSKLNRFNISYNPELVGPV

ProfileScan: PS51450
IPR001611
617-640 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

CVVSLDLSYNNLSGRIPSELQNLS

HMMPfam: PF00560
IPR001611
620-639 LRR_1
Leucine-rich repeat

SLDLSYNNLSGRIPSELQNL

Gene3D: G3DSA:2.60.120.200
IPR013320
769-832 ConA_like_subgrp
Concanavalin A-like lectin/glucanase, subgroup

GGKEHHRHFAPDHAAAASVQVSLFSVELPKHLTYSDLVSATSNFDETNVVGSGGFGIVYKAKLA

superfamily: SSF56112
IPR011009
782-1088 Kinase_like
Protein kinase-like domain

AAAASVQVSLFSVELPKHLTYSDLVSATSNFDETNVVGSGGFGIVYKAKLADGSTVAIKKLIQEGPQADREFLAEMETLGHLHHENLVPLLGCSSYGTQKLLVYKYMEKGSLDDWLHEKPGGAQALEWPIRLNIALGIARGLKFLHHNCSPPIVHRDMKASNILLDDNFEPRLTDFGLARVLGAQETHVSTVVAGTLGYVPPEYCQTWRATARGDVYSFGVVLLELVTGRRPMSISFGGENKDHGCGNLIEWSAYHVKKGIAAEVCDRIVLRSAAPGELLAFLRLAVVCTAELPIRRPTMREVLKVL

ProfileScan: PS50011
IPR000719
812-1091 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDETNVVGSGGFGIVYKAKLADGSTVAIKKLIQEGPQADREFLAEMETLGHLHHENLVPLLGCSSYGTQKLLVYKYMEKGSLDDWLHEKPGGAQALEWPIRLNIALGIARGLKFLHHNCSPPIVHRDMKASNILLDDNFEPRLTDFGLARVLGAQETHVSTVVAGTLGYVPPEYCQTWRATARGDVYSFGVVLLELVTGRRPMSISFGGENKDHGCGNLIEWSAYHVKKGIAAEVCDRIVLRSAAPGELLAFLRLAVVCTAELPIRRPTMREVLKVLEEI

HMMPfam: PF00069
IPR000719
815-1017 Pkinase,Ser-thr
Protein kinase, catalytic domain

TNVVGSGGFGIVYKAKLADGSTVAIKKLIQEGPQADREFLAEMETLGHLHHENLVPLLGCSSYGTQKLLVYKYMEKGSLDDWLHEKPGGAQALEWPIRLNIALGIARGLKFLHHNCSPPIVHRDMKASNILLDDNFEPRLTDFGLARVLGAQETHVSTVVAGTLGYVPPEYCQTWRATARGDVYSFGVVLLELVTGRRPMSIS

PatternScan: PS00107
IPR017441
818-841 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGSGGFGIVYKAKLADGSTVAIKK

Gene3D: G3DSA:3.30.200.20
833-874 G3DSA:3.30.200.20

DGSTVAIKKLIQEGPQADREFLAEMETLGHLHHENLVPLLGC

Gene3D: G3DSA:1.10.510.10
875-1086 G3DSA:1.10.510.10

SSYGTQKLLVYKYMEKGSLDDWLHEKPGGAQALEWPIRLNIALGIARGLKFLHHNCSPPIVHRDMKASNILLDDNFEPRLTDFGLARVLGAQETHVSTVVAGTLGYVPPEYCQTWRATARGDVYSFGVVLLELVTGRRPMSISFGGENKDHGCGNLIEWSAYHVKKGIAAEVCDRIVLRSAAPGELLAFLRLAVVCTAELPIRRPTMREVLK

PatternScan: PS00108
IPR008271
934-946 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDMKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox