PRGDB00182670 (109637)

From PRG Wiki
Jump to: navigation, search
109637
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Ectocarpus siliculosus

Comment?

Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (best arabidopsis hit)

DNA Sequence

ATGCCACTGTTTTCATGCTTCGGTGGAGGTGGTCTGAAGCATTCGGCCTCGGGAGGGCGGACCATTGTGAAAGGGAGCGAGCCAGAGCCTGTCGCTGTGGCGCAACCCTCGCCAAAGCAGCCGGAAGCAGCAGAGGTTAACGTGCTTGGTCCCGGGGCAAGCGGAGCACTTACGGGCTCTATAAGCAAGAAGTTGAGCAACTCCAGCTTTACCAGGAGCACTCAGGAAGCATCTGAGGACAAGGCCGCTGCGCCTGCTCAAGGCGCCGGGAGCGGAACCAGCAATCCAGCACCAGCTGCTGAACAGGCTCCATCTTCAGAGCCTGTGGAAGAGTCGACTGAGGAGGAGGAGACACGACCAGCACCCGAAGACGGGAAACCCGGCCCTGGCCGGGCTCCGGTTCCCCTGCCACAGCCGGGCTGCTATACACACAGTTTGAAGCTGACCAGCGAGCAAACACTTTGCCAATCGAACATTCAGCTTTGCAAACCAGAGGAGTTGGTGGGGGACATCAAGGACTTGGCATTCATTGGGAACGGTTCCTTTGCCGCGGTATTCAAGGGACTGTGGCAGGGTGCCAAAGTCGCTATAAAGTTTGTCGTCTCGGACAGTCTGAACTCAAACAGTGTGACGCTTCGCGAGTCCCTGCTTGGACAGCTGTTGTCTCATCCCAATGTCATCCAGACGTACACTACGCGGTGCGCGCTCATGGACGACGATTCGCTTGATGCCATCCACGGTTCGGCCACGGACGACGCACGACGGTTAAGCGGCGACAGCATGCGTTTCGTCAGTGGCGACGGGTTTGGCGACCCACGGCACAAAGCGGGAGGCGGCACGATTTCCGTCTCCAACATCCTGCTACAGTTGCAGGTCAAACCGGGCCAATACGTTGCCGTTGTCATCATGGAGTACGCGGACAGGGGTACGTTGCAGGAGGCAATTTATAAGCGGCAAGTCTTTCGGGAAAGCCCTCGATGGAACAAGCGCATTGCCGCCCGCGCCTTGTTCCGGACGGCGCGTGAGATTGCCCTGGGCATGCAGCACCTGCACAGCAGCAACGTTCTTCACGGCGACTTGAAGCCTGGAAATGTGCTCCTAACGTCTGCCCGTGTGGACCGCCGTGGCTTTATTGCCAAATTGGCGGACTTCGGACTCTCGCATGTGGCGCATGGGCCCATCGCGACGAATACGTGGGGGACTCTGCGCTACATGGCGCCTGAGCACTTCTCCGGCACCATGTCGAAGGCCACTGACGTCTTCGCCTTCGGGATGTTACTGTGGGAGATGGTCACGGGTAAGAAGCCGTACGAGAATATGACGCAGGGAGAGGTCATCCAGTCGGTCTCGCAGGGTCTCCGGCCGCAATGGCCGCCGGACTGCTTCCCGCACTTGGAGTACCTCGGTAAGCGCTGCATTGCGCACAATCCCGCGGATCGACCGTCGTTTGGGGAGATTGTGAAGGAGCTAGAGGATATGGAGGTCATGCTGCGAGAGCTGCTGCAGGCAACACGGGAGTCTACCGGCATGAACGCGGTGGGAGCCCCAGCAGGCAACTCCCCTTCACAGGCAGGTCTGCAGCCTGAACAACTGTAA


Protein sequences

Name Description Sequence
109637 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (best arabidopsis hit)

MPLFSCFGGGGLKHSASGGRTIVKGSEPEPVAVAQPSPKQPEAAEVNVLGPGASGALTGSISKKLSNSSFTRSTQEASEDKAAAPAQGAGSGTSNPAPAAEQAPSSEPVEESTEEEETRPAPEDGKPGPGRAPVPLPQPGCYTHSLKLTSEQTLCQSNIQLCKPEELVGDIKDLAFIGNGSFAAVFKGLWQGAKVAIKFVVSDSLNSNSVTLRESLLGQLLSHPNVIQTYTTRCALMDDDSLDAIHGSATDDARRLSGDSMRFVSGDGFGDPRHKAGGGTISVSNILLQLQVKPGQYVAVVIMEYADRGTLQEAIYKRQVFRESPRWNKRIAARALFRTAREIALGMQHLHSSNVLHGDLKPGNVLLTSARVDRRGFIAKLADFGLSHVAHGPIATNTWGTLRYMAPEHFSGTMSKATDVFAFGMLLWEMVTGKKPYENMTQGEVIQSVSQGLRPQWPPDCFPHLEYLGKRCIAHNPADRPSFGEIVKELEDMEVMLRELLQATRESTGMNAVGAPAGNSPSQAGLQPEQL*

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
94-123 G3DSA:3.30.200.20

SNPAPAAEQAPSSEPVEESTEEEETRPAPE

superfamily: SSF56112
IPR011009
143-513 Kinase_like
Protein kinase-like domain

THSLKLTSEQTLCQSNIQLCKPEELVGDIKDLAFIGNGSFAAVFKGLWQGAKVAIKFVVSDSLNSNSVTLRESLLGQLLSHPNVIQTYTTRCALMDDDSLDAIHGSATDDARRLSGDSMRFVSGDGFGDPRHKAGGGTISVSNILLQLQVKPGQYVAVVIMEYADRGTLQEAIYKRQVFRESPRWNKRIAARALFRTAREIALGMQHLHSSNVLHGDLKPGNVLLTSARVDRRGFIAKLADFGLSHVAHGPIATNTWGTLRYMAPEHFSGTMSKATDVFAFGMLLWEMVTGKKPYENMTQGEVIQSVSQGLRPQWPPDCFPHLEYLGKRCIAHNPADRPSFGEIVKELEDMEVMLRELLQATRESTGMNAV

Gene3D: G3DSA:3.30.200.20
165-240 G3DSA:3.30.200.20

EELVGDIKDLAFIGNGSFAAVFKGLWQGAKVAIKFVVSDSLNSNSVTLRESLLGQLLSHPNVIQTYTTRCALMDDD

HMMPanther: PTHR23257:SF99
170-525 PTHR23257:SF99,TGF-BETA-ACTIVATED KINASE 1

DIKDLAFIGNGSFAAVFKGLWQGAKVAIKFVVSDSLNSNSVTLRESLLGQLLSHPNVIQTYTTRCALMDDDSLDAIHGSATDDARRLSGDSMRFVSGDGFGDPRHKAGGGTISVSNILLQLQVKPGQYVAVVIMEYADRGTLQEAIYKRQVFRESPRWNKRIAARALFRTAREIALGMQHLHSSNVLHGDLKPGNVLLTSARVDRRGFIAKLADFGLSHVAHGPIATNTWGTLRYMAPEHFSGTMSKATDVFAFGMLLWEMVTGKKPYENMTQGEVIQSVSQGLRPQWPPDCFPHLEYLGKRCIAHNPADRPSFGEIVKELEDMEVMLRELLQATRESTGMNAVGAPAGNSPSQAG

HMMPanther: PTHR23257
170-525 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

DIKDLAFIGNGSFAAVFKGLWQGAKVAIKFVVSDSLNSNSVTLRESLLGQLLSHPNVIQTYTTRCALMDDDSLDAIHGSATDDARRLSGDSMRFVSGDGFGDPRHKAGGGTISVSNILLQLQVKPGQYVAVVIMEYADRGTLQEAIYKRQVFRESPRWNKRIAARALFRTAREIALGMQHLHSSNVLHGDLKPGNVLLTSARVDRRGFIAKLADFGLSHVAHGPIATNTWGTLRYMAPEHFSGTMSKATDVFAFGMLLWEMVTGKKPYENMTQGEVIQSVSQGLRPQWPPDCFPHLEYLGKRCIAHNPADRPSFGEIVKELEDMEVMLRELLQATRESTGMNAVGAPAGNSPSQAG

ProfileScan: PS50011
IPR000719
171-496 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

IKDLAFIGNGSFAAVFKGLWQGAKVAIKFVVSDSLNSNSVTLRESLLGQLLSHPNVIQTYTTRCALMDDDSLDAIHGSATDDARRLSGDSMRFVSGDGFGDPRHKAGGGTISVSNILLQLQVKPGQYVAVVIMEYADRGTLQEAIYKRQVFRESPRWNKRIAARALFRTAREIALGMQHLHSSNVLHGDLKPGNVLLTSARVDRRGFIAKLADFGLSHVAHGPIATNTWGTLRYMAPEHFSGTMSKATDVFAFGMLLWEMVTGKKPYENMTQGEVIQSVSQGLRPQWPPDCFPHLEYLGKRCIAHNPADRPSFGEIVKELEDMEVM

HMMPfam: PF00069
IPR000719
174-232 Pkinase,Ser-thr
Protein kinase, catalytic domain

LAFIGNGSFAAVFKGLWQGAKVAIKFVVSDSLNSNSVTLRESLLGQLLSHPNVIQTYTT

PatternScan: PS00107
IPR017441
177-198 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGNGSFAAVFKGLWQGAKVAIK

HMMPfam: PF07714
IPR001245
284-490 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SNILLQLQVKPGQYVAVVIMEYADRGTLQEAIYKRQVFRESPRWNKRIAARALFRTAREIALGMQHLHSSNVLHGDLKPGNVLLTSARVDRRGFIAKLADFGLSHVAHGPIATNTWGTLRYMAPEHFSGTMSKATDVFAFGMLLWEMVTGKKPYENMTQGEVIQSVSQGLRPQWPPDCFPHLEYLGKRCIAHNPADRPSFGEIVKEL

Gene3D: G3DSA:3.30.200.20
298-344 G3DSA:3.30.200.20

VAVVIMEYADRGTLQEAIYKRQVFRESPRWNKRIAARALFRTAREIA

Gene3D: G3DSA:1.10.510.10
345-494 G3DSA:1.10.510.10

LGMQHLHSSNVLHGDLKPGNVLLTSARVDRRGFIAKLADFGLSHVAHGPIATNTWGTLRYMAPEHFSGTMSKATDVFAFGMLLWEMVTGKKPYENMTQGEVIQSVSQGLRPQWPPDCFPHLEYLGKRCIAHNPADRPSFGEIVKELEDME

PatternScan: PS00108
IPR008271
355-367 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VLHGDLKPGNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox