PRGDB00182701 (107351)

From PRG Wiki
Jump to: navigation, search
107351
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type LRR
Gene Species Ectocarpus siliculosus

Comment?

plant intracellular ras group-related LRR 5 (best arabidopsis hit)

DNA Sequence

ATGTGCCAGGCCCTGCTGAGCTCAGGGCGCCGTTCCAACGTCTTCTCTTTGCCACCAGAAATCCTACATCTTATCTTCTCGGAGACTTTTGCAACAGACGCCTGTGCGGTGCAGCGGTTGCGAAGCGTCGATCGCGCATGGAATGCCCTTGCAAACGGCCTCGTCACGGGGCTCAGAGTTGCGCCAACGCCAGCGCCATTCGAGCTTGCCGCGCGCCTTCCCAACATAAAAATGATTATCATCGATCCTTCCGACACCCAAGCCGCAAGCGGCGCCAAACTCGCAGCTCTTCTTGCGCAATTATCCTCGTTGCCGGCCCTGGCGCGTCTTTCCATCCACGCCATCTGCTCGGCCGCCACAGCAGCCCTCACCAACCTCAGCCGCATCAGCCGCCTTGAATCCCTGGACCTATCCCGCTGCGATCTATCAGACCTTCCGCCTTCAGTCCTCGAACTGCAAAAACTCGAGGCTCTACGAGCCGCGGATTGCGGACTTTCTCGCCTAGGCGACCTGGGCGCCCTCGCCGCCTGCCTGCGCTGCCTCGACCTCAGCGGCAACAAGTTGACAAAGCTACCGGATGGCCTCTCGCGCCTCAGCCGTCTGACGTCCCTCAACGTGAGCAACAACAAGCTGTCAAGCGAGGTGCTAGTGCCCGAGCTGGGTGCTCTTCGGGAGTTGGCTGATCTTGACGTCGGCGGAAACAGTCTGGGTGTACTGCCAGGCTGTCTCCCGTGCCTCACGGCGCTCACCCGACTGGACGCGTCCGACTGTGACCTGGCCGCCCTGGGGGGGTCCGGACTTGAGCTGCTCACAGGTCTTCGCCAGCTCAACCTAAGTGGCAACTGGCGTCTGGGGCACTGCACGCCAGTCGTCACCGAGCTGACTCAACTGACACAGCTGGACGTGTCGGGTTGCGGGCTGGTGGGACTCCCTGTCGTACTGGGCTCTGCGACCCAGCTTCTGCAACTGCACCTCTCTGCCAACGACCTGCAACAGGTGCCCGAGTGCGTGTCCCGCCTCACCCGGCTCCGGTCGCTGCATCTGGACTTCAACTCCCTGTCAGTCCTGCCCTCCTTCCTGGCGGCCCTCTCCGCCCTCACCTCCCTGGACCTCAGCGGCAACTCCCTGACCGACCTGCCCGCCAGCATGAGCCGACTGACGGCCCTGAGGCACCTCACGCTGGCCAGCAATGCACTGGAGAGGGTTCCCGACTGCGTGGCGAACATGACAACTCTGCAGGAGCTGGACCTCTCCTGCAACCGGCTAGCTGCCCTCCCCGTCGCCCTGTGCTGCTCCTTGCCTTCCCTGGACTTCCTCTCCCTCGCCGGCAACTGCCTGACCCGGCTGCCCCCGGAGATCAGCCGCCTGTGCCGCCTCACCTGGCTCGATGTGGCGGACAACCGGCTGGACGGTCTGCCCGGGACATTGGCGGACATGGAGGGCCTGTTGGTGCTCAAGCTGCGGGGGAACTGCCTGGTGTCGCCCCGGCCGCCGGCGTTTAAGCGGTGGATGGCGCGTATGCGTTGCAGGGCGGCTGCCGCAGCCAGTGCAACTGCGGCGGTGGACGCAGCGGCCTGGGGGTTGTCGATGTCGGGATCTTGGTCGGTGAGGGTAGCGGCGGCGGCGGCGGCGGTGCCGTGTGCGCCCAGTGAGCGGGCGCGAGCGGCGGCCGCGGCGGACCTGGAGGCGGAGTACGAGGATGAGGAGGATGGCAGCGAGAGCGGGGGCAGTGGTGGGGGTGCGGGTGAGGAGGAGGGCGAAGACGAGGAGGAGGAAGAAGGAGAAGAAGACGAGAACGGCGATGTGGTGATGGCAGTGGCGGAGGCGGAGGCGGCAGGGCTGGGTGAAGGGTGGGATGACGGCGAGGAGCCGTTGGCTGGCGGCGGTGTTCATGGGGTCCATGGGGATGAGGGAGGCGCGCAGGTGGCGGGTGTTGGGGGTGGGGGTGGCTTGGGGCTGGGAGATGCAGCTTCAGAAGATGATGCGGATTCGGACAGCGACGGCGACAATCAGGGTGGGGATGAAGACGATGATATTGTCATCGGCGGCGACAGCGACAGCGAGGGGTCCGAGGCGGAAGGAGTCAGCGAGGAGGGCGATGGTGGAGGTGAGGGTGGTGCCGGTGAGGGAGAGGAGGACTTGGGGGTAGTGGCAGGAGGAGCGGAGCAGGCGGAAGGGGAGGAAGAGGACGAGGAGGGCGGATCAGATGGAAGCGAAGATGAAGAAAATGGCGGGGAGGAAGAGGCGGAGGTGGGGCCTGAGGCCGAGGGGGCAGCGGCTGCAGGAGGCCAGGAAGTTCTGGGAGCCCGGTGGTGGGAGGTTCTACCGGTAGCTAGCGACCTCGCCAATGCGAAGTCGGATACGGATTCAGCGCTTGTCAGCGATTGCCCTGGAGTTTCAGGTCTTGGGGAGGGCTTCCACAGCGAGGGTGTCCCCCGGGCACACAAGGTATACGGCCCTCCACAGTCCAAGCGTGTCATCCACTTTGTGGCTCAGCAGCAATGCAGCACGTCGTTTGGAGAAAGTGACCGAGAACCAACGTCAACTTCTCCAACCCACGTCAACAATCGCAACCACAAAAACGCAACGAAACATAATCACTGCTTGGACCTCCAATTATAA


Protein sequences

Name Description Sequence
107351 plant intracellular ras group-related LRR 5 (best arabidopsis hit)

MCQALLSSGRRSNVFSLPPEILHLIFSETFATDACAVQRLRSVDRAWNALANGLVTGLRVAPTPAPFELAARLPNIKMIIIDPSDTQAASGAKLAALLAQLSSLPALARLSIHAICSAATAALTNLSRISRLESLDLSRCDLSDLPPSVLELQKLEALRAADCGLSRLGDLGALAACLRCLDLSGNKLTKLPDGLSRLSRLTSLNVSNNKLSSEVLVPELGALRELADLDVGGNSLGVLPGCLPCLTALTRLDASDCDLAALGGSGLELLTGLRQLNLSGNWRLGHCTPVVTELTQLTQLDVSGCGLVGLPVVLGSATQLLQLHLSANDLQQVPECVSRLTRLRSLHLDFNSLSVLPSFLAALSALTSLDLSGNSLTDLPASMSRLTALRHLTLASNALERVPDCVANMTTLQELDLSCNRLAALPVALCCSLPSLDFLSLAGNCLTRLPPEISRLCRLTWLDVADNRLDGLPGTLADMEGLLVLKLRGNCLVSPRPPAFKRWMARMRCRAAAAASATAAVDAAAWGLSMSGSWSVRVAAAAAAVPCAPSERARAAAAADLEAEYEDEEDGSESGGSGGGAGEEEGEDEEEEEGEEDENGDVVMAVAEAEAAGLGEGWDDGEEPLAGGGVHGVHGDEGGAQVAGVGGGGGLGLGDAASEDDADSDSDGDNQGGDEDDDIVIGGDSDSEGSEAEGVSEEGDGGGEGGAGEGEEDLGVVAGGAEQAEGEEEDEEGGSDGSEDEENGGEEEAEVGPEAEGAAAAGGQEVLGARWWEVLPVASDLANAKSDTDSALVSDCPGVSGLGEGFHSEGVPRAHKVYGPPQSKRVIHFVAQQQCSTSFGESDREPTSTSPTHVNNRNHKNATKHNHCLDLQL*


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF80
10-534 PTHR23155:SF80,PREDICTED PROTEIN

RRSNVFSLPPEILHLIFSETFATDACAVQRLRSVDRAWNALANGLVTGLRVAPTPAPFELAARLPNIKMIIIDPSDTQAASGAKLAALLAQLSSLPALARLSIHAICSAATAALTNLSRISRLESLDLSRCDLSDLPPSVLELQKLEALRAADCGLSRLGDLGALAACLRCLDLSGNKLTKLPDGLSRLSRLTSLNVSNNKLSSEVLVPELGALRELADLDVGGNSLGVLPGCLPCLTALTRLDASDCDLAALGGSGLELLTGLRQLNLSGNWRLGHCTPVVTELTQLTQLDVSGCGLVGLPVVLGSATQLLQLHLSANDLQQVPECVSRLTRLRSLHLDFNSLSVLPSFLAALSALTSLDLSGNSLTDLPASMSRLTALRHLTLASNALERVPDCVANMTTLQELDLSCNRLAALPVALCCSLPSLDFLSLAGNCLTRLPPEISRLCRLTWLDVADNRLDGLPGTLADMEGLLVLKLRGNCLVSPRPPAFKRWMARMRCRAAAAASATAAVDAAAWGLSMSGSW

HMMPanther: PTHR23155
10-534 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

RRSNVFSLPPEILHLIFSETFATDACAVQRLRSVDRAWNALANGLVTGLRVAPTPAPFELAARLPNIKMIIIDPSDTQAASGAKLAALLAQLSSLPALARLSIHAICSAATAALTNLSRISRLESLDLSRCDLSDLPPSVLELQKLEALRAADCGLSRLGDLGALAACLRCLDLSGNKLTKLPDGLSRLSRLTSLNVSNNKLSSEVLVPELGALRELADLDVGGNSLGVLPGCLPCLTALTRLDASDCDLAALGGSGLELLTGLRQLNLSGNWRLGHCTPVVTELTQLTQLDVSGCGLVGLPVVLGSATQLLQLHLSANDLQQVPECVSRLTRLRSLHLDFNSLSVLPSFLAALSALTSLDLSGNSLTDLPASMSRLTALRHLTLASNALERVPDCVANMTTLQELDLSCNRLAALPVALCCSLPSLDFLSLAGNCLTRLPPEISRLCRLTWLDVADNRLDGLPGTLADMEGLLVLKLRGNCLVSPRPPAFKRWMARMRCRAAAAASATAAVDAAAWGLSMSGSW

superfamily: SSF52058
87-333 SSF52058,LRR

QAASGAKLAALLAQLSSLPALARLSIHAICSAATAALTNLSRISRLESLDLSRCDLSDLPPSVLELQKLEALRAADCGLSRLGDLGALAACLRCLDLSGNKLTKLPDGLSRLSRLTSLNVSNNKLSSEVLVPELGALRELADLDVGGNSLGVLPGCLPCLTALTRLDASDCDLAALGGSGLELLTGLRQLNLSGNWRLGHCTPVVTELTQLTQLDVSGCGLVGLPVVLGSATQLLQLHLSANDLQQV

Gene3D: G3DSA:3.80.10.10
98-273 G3DSA:3.80.10.10

LAQLSSLPALARLSIHAICSAATAALTNLSRISRLESLDLSRCDLSDLPPSVLELQKLEALRAADCGLSRLGDLGALAACLRCLDLSGNKLTKLPDGLSRLSRLTSLNVSNNKLSSEVLVPELGALRELADLDVGGNSLGVLPGCLPCLTALTRLDASDCDLAALGGSGLELLTGL

HMMPfam: PF00560
IPR001611
131-150 LRR_1
Leucine-rich repeat

RLESLDLSRCDLSDLPPSVL

ProfileScan: PS51450
IPR001611
131-152 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLESLDLSRCDLSDLPPSVLEL

ProfileScan: PS51450
IPR001611
154-175 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLEALRAADCGLSRLGDLGALA

ProfileScan: PS51450
IPR001611
177-199 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

CLRCLDLSGNKLTKLPDGLSRLS

HMMPfam: PF12799
178-213 LRR_4,Leucine Rich repeats (2 copies)

LRCLDLSGNKLTKLPDGLSRLSRLTSLNVSNNKLSS

ProfileScan: PS51450
IPR001611
200-221 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTSLNVSNNKLSSEVLVPELG

ProfileScan: PS51450
IPR001611
225-247 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELADLDVGGNSLGVLPGCLPCLT

ProfileScan: PS51450
IPR001611
272-294 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRQLNLSGNWRLGHCTPVVTEL

Gene3D: G3DSA:3.80.10.10
274-415 G3DSA:3.80.10.10

RQLNLSGNWRLGHCTPVVTELTQLTQLDVSGCGLVGLPVVLGSATQLLQLHLSANDLQQVPECVSRLTRLRSLHLDFNSLSVLPSFLAALSALTSLDLSGNSLTDLPASMSRLTALRHLTLASNALERVPDCVANMTTLQEL

superfamily: SSF52058
286-493 SSF52058,LRR

HCTPVVTELTQLTQLDVSGCGLVGLPVVLGSATQLLQLHLSANDLQQVPECVSRLTRLRSLHLDFNSLSVLPSFLAALSALTSLDLSGNSLTDLPASMSRLTALRHLTLASNALERVPDCVANMTTLQELDLSCNRLAALPVALCCSLPSLDFLSLAGNCLTRLPPEISRLCRLTWLDVADNRLDGLPGTLADMEGLLVLKLRGNCLV

HMMPfam: PF13504
295-311 LRR_7,Leucine rich repeat

TQLTQLDVSGCGLVGLP

ProfileScan: PS51450
IPR001611
319-341 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLLQLHLSANDLQQVPECVSRLT

HMMPfam: PF13855
342-399 LRR_8,Leucine rich repeat

RLRSLHLDFNSLSVLPSFLAALSALTSLDLSGNSLTDLPASMSRLTALRHLTLASNAL

ProfileScan: PS51450
IPR001611
342-363 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLRSLHLDFNSLSVLPSFLAAL

ProfileScan: PS51450
IPR001611
365-386 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALTSLDLSGNSLTDLPASMSRL

FPrintScan: PR00019
366-379 LEURICHRPT,Leucine-rich repeat signature

LTSLDLSGNSLTDL

ProfileScan: PS51450
IPR001611
388-409 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALRHLTLASNALERVPDCVANM

FPrintScan: PR00019
409-422 LEURICHRPT,Leucine-rich repeat signature

MTTLQELDLSCNRL

ProfileScan: PS51450
IPR001611
411-432 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLQELDLSCNRLAALPVALCCS

HMMPfam: PF13855
411-469 LRR_8,Leucine rich repeat

TLQELDLSCNRLAALPVALCCSLPSLDFLSLAGNCLTRLPPEISRLCRLTWLDVADNRL

Gene3D: G3DSA:3.80.10.10
416-497 G3DSA:3.80.10.10

DLSCNRLAALPVALCCSLPSLDFLSLAGNCLTRLPPEISRLCRLTWLDVADNRLDGLPGTLADMEGLLVLKLRGNCLVSPRP

ProfileScan: PS51450
IPR001611
435-456 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLDFLSLAGNCLTRLPPEISRL

ProfileScan: PS51450
IPR001611
458-480 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLTWLDVADNRLDGLPGTLADME






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox