PRGDB00182709 (106826)

From PRG Wiki
Jump to: navigation, search
106826
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Ectocarpus siliculosus

Comment?

ACT-like protein tyrosine kinase family protein (best arabidopsis hit)

DNA Sequence

ATGGATCAGCCGCTTCTGGTCCTTAGTTCGCTGGGCCAGTTCTGCGGATTGTTTGCGGGCTGCTCGGGCTGCAGCTGTTTGCGCCAGAAAGAACGTCTGGATCTGCTGCTCCCCTGCGCTCCGGGCGCCGGGGCGGTGTTGGAGGTGGCGGACACGCTGGGAGTGCACCCGGAGTCCCTGAGGGCAATCAGGCGACCCCCCTCCGTCCCCGGAGTCCAGTCGTACCAAGTAACGCTGTCTCAGGACGGTTGCGTCAACGACCCTGCCGTACACCCCCGGCAGCGATGCTGGCCGCATCGCGGCCTGTACAACGATGTTGCCATGCCGGGCGCAGATCCCAATGGCTACAATGGCGTCAAACTGACGGGCTACATCATACACATGCTGCAACTCTCTAGCTCTCGGGCTCATCGACCAGTATCGATCCCTAGCGTGCGGATGAAGGAAGCCGGGAAGAAGGTCGTTTACCTCTGTGATGTGTTGCTCACGGAGGCGTGTGTGGAGAACCTGACGGCATTGGGTTGCGCCACGAGGACGTACGGCACACTCGACCCCCCCTGGACACCGCTGACGTTGGCACAGGGCGGAGGGCACCCGCCACTGCCGTACCGAGGAGCTCCCAGGGATATCGTCATGCATACTGATGACGTGGCGGATGCTGGTACGGCAGGTGTTTCAGGGGGCCGCGAGGGAAGGCGGCTGAGCCCGGCGGCGAAGGGCGGCCTCGCGGGAGGTTTGGTGGCGGCGGCATTGGCGGCGGTGGCGGCGGTGGTGCTGCTGCTGCGGCGACGAGGAAGGCCGCCAGCTGCAGCCCCCAACACCCCACTCCCCTCCTCCGTCCCCCCACAAAACCCCTCCTCCTCCTCCTTCAACGCCCCGTGGTGGTGGTGCCGTGTACGACATCTCATGAGGGCGCCTCCGGGCAACCCGTGCTGGGTCAACACAGCGACGACTGCCGCTGCCGGGGGCGATACTACCGAAGCTAAATTGAAGGTGCCTTCCTCGACGCCCAACTCCGCCCCGTGCTCGGCCTCCTCCCACAATGAGGGGGACGGGGGTGACAGCAATGACGCTGCCGCCAAGGCCACTTCGCAAAAAAGTAAATCAACGTTGAAGGCGATGCTGTCAGTTCTTGGCAGCGACTGCGGAGCCTCGGTCTTATCCAGACCATCCAGGTTCGAATCCTTCCCCCGACATCGGCGCTCGACCAGCGAAGTGGTGGAGCCGTCTGATGCGGCATCCCCCGAGGCTGCAGCCGCTGACAGTGCTACAGCCGCGGGAATTGTAGCTGCTGGCAGTGCAGGAGCAGCGGGGGGGCCCGGGGTAATAGCTGTAGCAGCCGTAGCAGTAGCAGCAGTAGGGGTGGTTGGCGGGTATGGACGCTGTAGCGCGCCTGCGGGGATTCGTCATCCCTCGAGTGAGGCCGCGGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGTGATGGAGATGGTGGCAAGGGCGGGGGAGGGAGGGGGGGATGCGGCTGGGGAGGGACTGCTGCGGCGGTAAATACGGCGGATGGCATCCGCAATCTGCCGGGCAATGTGCCGGTGCCCTCAACCTCCGACGGCGAGCGGCGGCGGCCTCGGGAAGCAGGAGGAGGTGCGGACGGCGATGCGGAGTCCGCTGCGGCTGCGCAGTCGCCGTCTCCCCCCCGCGGGGCTCCTTCGTCAGTCGCGGCGGGGGTGGTGGTGACGCCCCGCACCCCCCACCGCCCCGACATCAACCTCAAGCTCCGTTTTGTCAGGCCTCAACAAACCCCATCACAAGAACAAGACCAACAACACCAGCAACTGAAGCCGGGCGACACGAACACCCCCAGCCCCCCCAACCCCCCCAACCCCCCCAACCCCCACTCCCACACCAAACAACTAGAACCCCAATCCCCCCGGGTCGGGGGTGAGGTGCGGGACTCGGAACAGGGTCAGACAGAGACCCCTCTCGCCGACGGCGCTGCAGTACGGCACCTCCACAATGCCCCCTCGACCTCCCCCTCGGCCTCCCCCTCGGCCTCCACGACTGCCCGCGAAGAGGAGCTCGTCCTGCTTCCCGTCCTCCGCGGCAAGGGCTCCTTCGGGCGGGTGGTGGAGGGGCGATACCGGGGGGGCCTGGTGGCTGTGAAGCTGCTGACGGGTGCGGGTATGGTCCCGGGACCCCCCCCGGGGGGCGGCGGCGACCACCGCCTCCTGCGCAGCTTCACACACGAGGTGGAGGTGCTGGCGAGGTGCGACCACCGTAATGTGGTACGGCTGCTGGCGGCGTGTTGCTGTCCCCCGCCGCGTCTGTGTTTGGTTATGGAGCTGATGGACACCTCCCTGGAGTGTATGATTCGGGAGGCGCCGGGCCGGTTGCTGCCCATGAGCGCGGTATTGGATATTGCAGTGGACATTGCCCGCGGCCTGGAATACCTACATCCCACCATAGTGCACCGGGACCTCAAGCCCGCCAACGTGCTGGTCAACGACCCTCTGGGCCCGAACCAGGTCGCCAAACTGTCGGACTTCGGTCTGGCGCGTCTGAGCTGTTCGGAGCTCCGTACGCGGCACCCGGAGGCGGGCACGCCTGCGTACATGGCCCCCGAGTGCTTTGACGTCACCGTGTCGGCCATCACGTGCCGAGTGGACATCTACGCGTTAGGTAAGTTTGACTTTTTACTGATCGGCGGTTGGCGGTTAGCGGGCCTCAACTTCATGCGCCTTGCCCTCAAGGTCACCTACGGCCAGGAGCGGCCCCCCCTGTCCGCCACACCGCCCGGCCGCCGCGTCCCCAAGCTGCTGCGCCTCGTGCAGCGCTGCTGGGATCAGGACCCGCGCAGGAGACCGGCGGCGGCGGAGGTGGCCAAGGAGCTGGCGCTTGTACGGGAGATGGTACGACAGCAACAGCAGCAGGAACAGGTGCCGGTGCCGGTGGTGGAGGTTTGTGTTGGGGGGGGGGAGAGGTGCATTGCGCCACCACGGGCACCAGGAGGGCCGATACTGGTGGGTTCCGTTGCTGGGATTCTGCAGAATCCAAACGTCGTGGGGTCGGGCTACATTCAGTTCCCGCCACAGCGGCCCTTTGAGAAGCCTGTGGTCTTCCAGCCACCGACGGTTGCGGCGGTGCAGCCCCCTCCGGCATACAGCGCTCGCCCGCAGGGTCCACCGCCGCAGCAGTACAGGCCGCCGCAGCAGAGCCACTACAACCAGCAACCTGCGAGGCCCCCCGCTCCACAGGTGCCGCCGCCGCAGCGGGCGCCCCAGGGGCCCCCTCCACCCCGGCCGGCTGCGCCGCCGCCGCAGTATACGCCCCGGCCAGCTGCGCCCCCGCCGCAGCCGCAGCCGGCTGCACGTCCCCCGGCACCGCAGCCCCAGTTGCAGCGGCCCGTCTCTGCCGCGCCGAGGCCGACTTCCGCGGCCTTGCAGCACCCCTCGCCACGGCCCGGTGTCCACGTTCCGGCCCCGCACCACCCTGCTCCGGCCCATCCCCCCTCTCACGGGGCCGCCGCGGCGGCGTCCTCTGCTGCAGCTGCTCACGCACACCACCAAGCAGCTCAGAAGATTCAGGCAGCTGCGATCACCCAGGCGCACGCGCTGGCGCACAAGGTCCAGGCTGTGCAGTTGACGGAGAGCGACGACGAGGGTGATGAGGGCAAGGGCGGTCTCAGCAAGTCGCAGAAGAAGCGCCTGCGCAAGAAGCTGCGGGATGCCACGGCCGCAAAGTGA


Protein sequences

Name Description Sequence
106826 ACT-like protein tyrosine kinase family protein (best arabidopsis hit)

MDQPLLVLSSLGQFCGLFAGCSGCSCLRQKERLDLLLPCAPGAGAVLEVADTLGVHPESLRAIRRPPSVPGVQSYQVTLSQDGCVNDPAVHPRQRCWPHRGLYNDVAMPGADPNGYNGVKLTGYIIHMLQLSSSRAHRPVSIPSVRMKEAGKKVVYLCDVLLTEACVENLTALGCATRTYGTLDPPWTPLTLAQGGGHPPLPYRGAPRDIVMHTDDVADAGTAGVSGGREGRRLSPAAKGGLAGGLVAAALAAVAAVVLLLRRRGRPPAAAPNTPLPSSVPPQNPSSSSFNAPWWWCRVRHLMRAPPGNPCWVNTATTAAAGGDTTEAKLKVPSSTPNSAPCSASSHNEGDGGDSNDAAAKATSQKSKSTLKAMLSVLGSDCGASVLSRPSRFESFPRHRRSTSEVVEPSDAASPEAAAADSATAAGIVAAGSAGAAGGPGVIAVAAVAVAAVGVVGGYGRCSAPAGIRHPSSEAAGGGGGGGGGGGDGDGGKGGGGRGGCGWGGTAAAVNTADGIRNLPGNVPVPSTSDGERRRPREAGGGADGDAESAAAAQSPSPPRGAPSSVAAGVVVTPRTPHRPDINLKLRFVRPQQTPSQEQDQQHQQLKPGDTNTPSPPNPPNPPNPHSHTKQLEPQSPRVGGEVRDSEQGQTETPLADGAAVRHLHNAPSTSPSASPSASTTAREEELVLLPVLRGKGSFGRVVEGRYRGGLVAVKLLTGAGMVPGPPPGGGGDHRLLRSFTHEVEVLARCDHRNVVRLLAACCCPPPRLCLVMELMDTSLECMIREAPGRLLPMSAVLDIAVDIARGLEYLHPTIVHRDLKPANVLVNDPLGPNQVAKLSDFGLARLSCSELRTRHPEAGTPAYMAPECFDVTVSAITCRVDIYALGKFDFLLIGGWRLAGLNFMRLALKVTYGQERPPLSATPPGRRVPKLLRLVQRCWDQDPRRRPAAAEVAKELALVREMVRQQQQQEQVPVPVVEVCVGGGERCIAPPRAPGGPILVGSVAGILQNPNVVGSGYIQFPPQRPFEKPVVFQPPTVAAVQPPPAYSARPQGPPPQQYRPPQQSHYNQQPARPPAPQVPPPQRAPQGPPPPRPAAPPPQYTPRPAAPPPQPQPAARPPAPQPQLQRPVSAAPRPTSAALQHPSPRPGVHVPAPHHPAPAHPPSHGAAAAASSAAAAHAHHQAAQKIQAAAITQAHALAHKVQAVQLTESDDEGDEGKGGLSKSQKKRLRKKLRDATAAK*

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
657-965 Kinase_like
Protein kinase-like domain

DGAAVRHLHNAPSTSPSASPSASTTAREEELVLLPVLRGKGSFGRVVEGRYRGGLVAVKLLTGAGMVPGPPPGGGGDHRLLRSFTHEVEVLARCDHRNVVRLLAACCCPPPRLCLVMELMDTSLECMIREAPGRLLPMSAVLDIAVDIARGLEYLHPTIVHRDLKPANVLVNDPLGPNQVAKLSDFGLARLSCSELRTRHPEAGTPAYMAPECFDVTVSAITCRVDIYALGKFDFLLIGGWRLAGLNFMRLALKVTYGQERPPLSATPPGRRVPKLLRLVQRCWDQDPRRRPAAAEVAKELALVREMVR

Gene3D: G3DSA:3.30.200.20
664-776 G3DSA:3.30.200.20

LHNAPSTSPSASPSASTTAREEELVLLPVLRGKGSFGRVVEGRYRGGLVAVKLLTGAGMVPGPPPGGGGDHRLLRSFTHEVEVLARCDHRNVVRLLAACCCPPPRLCLVMELM

ProfileScan: PS50011
IPR000719
688-959 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

VLLPVLRGKGSFGRVVEGRYRGGLVAVKLLTGAGMVPGPPPGGGGDHRLLRSFTHEVEVLARCDHRNVVRLLAACCCPPPRLCLVMELMDTSLECMIREAPGRLLPMSAVLDIAVDIARGLEYLHPTIVHRDLKPANVLVNDPLGPNQVAKLSDFGLARLSCSELRTRHPEAGTPAYMAPECFDVTVSAITCRVDIYALGKFDFLLIGGWRLAGLNFMRLALKVTYGQERPPLSATPPGRRVPKLLRLVQRCWDQDPRRRPAAAEVAKELAL

HMMPfam: PF00069
IPR000719
695-955 Pkinase,Ser-thr
Protein kinase, catalytic domain

GKGSFGRVVEGRYRGGLVAVKLLTGAGMVPGPPPGGGGDHRLLRSFTHEVEVLARCDHRNVVRLLAACCCPPPRLCLVMELMDTSLECMIREAPGRLLPMSAVLDIAVDIARGLEYLHPTIVHRDLKPANVLVNDPLGPNQVAKLSDFGLARLSCSELRTRHPEAGTPAYMAPECFDVTVSAITCRVDIYALGKFDFLLIGGWRLAGLNFMRLALKVTYGQERPPLSATPPGRRVPKLLRLVQRCWDQDPRRRPAAAEVAK

HMMPanther: PTHR23257:SF309
743-964 PTHR23257:SF309

EVEVLARCDHRNVVRLLAACCCPPPRLCLVMELMDTSLECMIREAPGRLLPMSAVLDIAVDIARGLEYLHPTIVHRDLKPANVLVNDPLGPNQVAKLSDFGLARLSCSELRTRHPEAGTPAYMAPECFDVTVSAITCRVDIYALGKFDFLLIGGWRLAGLNFMRLALKVTYGQERPPLSATPPGRRVPKLLRLVQRCWDQDPRRRPAAAEVAKELALVREMV

HMMPanther: PTHR23257
743-964 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

EVEVLARCDHRNVVRLLAACCCPPPRLCLVMELMDTSLECMIREAPGRLLPMSAVLDIAVDIARGLEYLHPTIVHRDLKPANVLVNDPLGPNQVAKLSDFGLARLSCSELRTRHPEAGTPAYMAPECFDVTVSAITCRVDIYALGKFDFLLIGGWRLAGLNFMRLALKVTYGQERPPLSATPPGRRVPKLLRLVQRCWDQDPRRRPAAAEVAKELALVREMV

Gene3D: G3DSA:1.10.510.10
779-960 G3DSA:1.10.510.10

SLECMIREAPGRLLPMSAVLDIAVDIARGLEYLHPTIVHRDLKPANVLVNDPLGPNQVAKLSDFGLARLSCSELRTRHPEAGTPAYMAPECFDVTVSAITCRVDIYALGKFDFLLIGGWRLAGLNFMRLALKVTYGQERPPLSATPPGRRVPKLLRLVQRCWDQDPRRRPAAAEVAKELALV

PatternScan: PS00108
IPR008271
815-827 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKPANVLV

Gene3D: G3DSA:1.10.510.10
1042-1105 G3DSA:1.10.510.10

QPPPAYSARPQGPPPQQYRPPQQSHYNQQPARPPAPQVPPPQRAPQGPPPPRPAAPPPQYTPRP

FPrintScan: PR01217
1043-1055 PRICHEXTENSN,Proline rich extensin signature

PPPAYSARPQGPP

FPrintScan: PR01217
1087-1108 PRICHEXTENSN,Proline rich extensin signature

QGPPPPRPAAPPPQYTPRPAAP

FPrintScan: PR01217
1108-1124 PRICHEXTENSN,Proline rich extensin signature

PPPQPQPAARPPAPQPQ

FPrintScan: PR01217
1138-1163 PRICHEXTENSN,Proline rich extensin signature

AALQHPSPRPGVHVPAPHHPAPAHPP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox