PRGDB00182727 (106486)

From PRG Wiki
Jump to: navigation, search
106486
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type
Gene Species Ectocarpus siliculosus

Comment?

LAG1 longevity assurance homolog 3 (best arabidopsis hit)

DNA Sequence

ATGGAGACTCAGCCCCAGCTGCAGCTCGAGAAACTTTCAACCCTGGGCCGATGGATATATGAAAGCGGCGTGAAGTTGAACGTTGTCAACACAACGTTAACAGCTTTAAATGTATCACCGGAGCCTGATGTGGCGTACCTGTTGGGGGACCGGTACCTGGACTTCTCCTTGTGCGTAGTTTTCGCCCTCTTGTACCCGGTTATTAGGGGCATCCTTACACGCTTCGTCTTCGAGCCTTTGGGCAAGCGGGCGCTCTCAGGCGGTGATCCGAAAAAGACTGATGTGCAAGTGGACGAACAGGAACAGGCGAGGAAGCTTCGAAAGTGGAACGAATCCTGCTGGAAAATGACAGTTTACATAGCCTTCACAGCTTTGGCCTTCGCAGTCTGCTGGGGCGAGATTTGGTTCACAGACAGCCGCTATTGGTGGCTAGGTTGTTCGCGGTTTCCTCCGTGTAACCTCCCTGTATCTCGCGGCGTGCTGCTCTTCTACTGCGCTGAGACTGGTTTCTATCTCCAAGCAATACATTTCCTCGCTGTGCACGAGGAACGGCGGAAAGACTGGCTGGAGAGCATGATCCACCACGTAGTGACGTCGGGACTACTATTCTATTCTTATGCGGTCAACTTCACCCGCGTCGGAGTTGTTGTGATTCTGATTCACGACGTGTCCGATATCTTCCTGGAAATGGCCAAGCTTGCCCGCTACGCAGACCGCAACGATATAGGCATGCCGGCATTCATCGTCTTCTTCGTGTCGTGGGTTGTGGCCCGAGTACTTATTTTCCCAGCTTACGTTATCCGTTCGACGCTGTTCGAGCCGGTCATGCTGGTGGCTGCCCAGCTGGGGATCGAGCCGCATCCGCACTGGGAGATTTTCAACGGCCTTTTGCTGGTGCTGTTTGTCCTCCATCTGTATTGGACGGTGCTCATCTTCCAAGTCATTCAACGGCAGTTTACGCACGGGAAAATGACGGATGTTCGTGAAGCGGGGGAGGAGTAA


Protein sequences

Name Description Sequence
106486 LAG1 longevity assurance homolog 3 (best arabidopsis hit)

METQPQLQLEKLSTLGRWIYESGVKLNVVNTTLTALNVSPEPDVAYLLGDRYLDFSLCVVFALLYPVIRGILTRFVFEPLGKRALSGGDPKKTDVQVDEQEQARKLRKWNESCWKMTVYIAFTALAFAVCWGEIWFTDSRYWWLGCSRFPPCNLPVSRGVLLFYCAETGFYLQAIHFLAVHEERRKDWLESMIHHVVTSGLLFYSYAVNFTRVGVVVILIHDVSDIFLEMAKLARYADRNDIGMPAFIVFFVSWVVARVLIFPAYVIRSTLFEPVMLVAAQLGIEPHPHWEIFNGLLLVLFVLHLYWTVLIFQVIQRQFTHGKMTDVREAGEE*


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR12560
40-329 PTHR12560,LONGEVITY ASSURANCE FACTOR 1 (LAG1)

PEPDVAYLLGDRYLDFSLCVVFALLYPVIRGILTRFVFEPLGKRALSGGDPKKTDVQVDEQEQARKLRKWNESCWKMTVYIAFTALAFAVCWGEIWFTDSRYWWLGCSRFPPCNLPVSRGVLLFYCAETGFYLQAIHFLAVHEERRKDWLESMIHHVVTSGLLFYSYAVNFTRVGVVVILIHDVSDIFLEMAKLARYADRNDIGMPAFIVFFVSWVVARVLIFPAYVIRSTLFEPVMLVAAQLGIEPHPHWEIFNGLLLVLFVLHLYWTVLIFQVIQRQFTHGKMTDVRE

ProfileScan: PS50922
IPR006634
107-320 TLC
TRAM/LAG1/CLN8 homology domain

RKWNESCWKMTVYIAFTALAFAVCWGEIWFTDSRYWWLGCSRFPPCNLPVSRGVLLFYCAETGFYLQAIHFLAVHEERRKDWLESMIHHVVTSGLLFYSYAVNFTRVGVVVILIHDVSDIFLEMAKLARYADRNDIGMPAFIVFFVSWVVARVLIFPAYVIRSTLFEPVMLVAAQLGIEPHPHWEIFNGLLLVLFVLHLYWTVLIFQVIQRQFT

HMMSmart: SM00724
IPR006634
107-320 TLC
TRAM/LAG1/CLN8 homology domain

RKWNESCWKMTVYIAFTALAFAVCWGEIWFTDSRYWWLGCSRFPPCNLPVSRGVLLFYCAETGFYLQAIHFLAVHEERRKDWLESMIHHVVTSGLLFYSYAVNFTRVGVVVILIHDVSDIFLEMAKLARYADRNDIGMPAFIVFFVSWVVARVLIFPAYVIRSTLFEPVMLVAAQLGIEPHPHWEIFNGLLLVLFVLHLYWTVLIFQVIQRQFT

HMMPfam: PF03798
IPR006634
108-312 TRAM_LAG1_CLN8
TRAM/LAG1/CLN8 homology domain

KWNESCWKMTVYIAFTALAFAVCWGEIWFTDSRYWWLGCSRFPPCNLPVSRGVLLFYCAETGFYLQAIHFLAVHEERRKDWLESMIHHVVTSGLLFYSYAVNFTRVGVVVILIHDVSDIFLEMAKLARYADRNDIGMPAFIVFFVSWVVARVLIFPAYVIRSTLFEPVMLVAAQLGIEPHPHWEIFNGLLLVLFVLHLYWTVLIF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox