PRGDB00182742 (107413)

From PRG Wiki
Jump to: navigation, search
107413
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class N
Domain Type NBS
Gene Species Ectocarpus siliculosus

Comment?

ABC-2 and Plant PDR ABC-type transporter family protein (best arabidopsis hit)

DNA Sequence

ATGTCTGATACAAGCATGCCCGATGTCGTTGACGTCGAGGCAGGCATGGTCGCCAAATCAAGCGTTTCCGATGCAGCGTTCTTCAAGCGCCGCAGCAGCAGCGACAATACCAGCAGCGCAAATAATGTGCAGGCTGGGCTATGCATCCTCATGAAGGATCTGTCGTATCACGTTGCCTCCAATAGCCAGCGTGGCGAGCGGGCTTACCTCTTGAAGGGTGTGAGCGCTTACCTAGAGCCTGGTCAGATGACAGCCTTGATGGGACCCAGCGGCAGTGGAAAGACCACATTGCTCGACCTGCTCGCGGGTCGCAAGACAGTCGGCAAGACGGAAGGCCATCTCAGCTTTGGCGGCTCACAGCCCACCAAGCAGTTCCTGAGGCGCTACACGGGATATGTCGAGCAGTTCGACACGCTGCTTGGGGATCTGACTGTACGGGAGATGCTGATGTATACGGCGGAGCTTAAGAGACCCATGGAAGAGCCCCTTGCTGACAAGAGGAGGGAGGTAGAGGTGTTGCTGCAGAGGCTGGCTCTGAGCAACTGTTCGGATGTCAAGATTGGCGATCCGATGTCGAAGGGCATCAGCGCCGTACAGCGCTTCCATTTCGTTTCCCTTCCGTACTTGCTGATCGGCATCGCTCTCATTTCCAACCCGCGTGTGCTGTTCCTGGATGAACCCACCTCGGGTCTGGACAGCTACACAGCCAACGAGGTGATGAAGGTGGTGCGGGGCCTTGCGGCCGATGGCACCACCATCGCCGCCACCATCCACAGCCCCACCGCCGCCACCTTCGCGCTCTTCGACCGGGTGATGCTGCTGGTCCGCGGCCAGCTGGTCTACTTTGGTCCTCAGGGTCTTCCGGCGCTCCAATTTGCGGCGGCCGAATGGCCCTCCTCCACCGCGGCGTCGGAGCTGCTGGAGCTTCACCGCCGCGCCACCGTACAACAGACCGCTACCGGCGGCGACGGTGGCGTTGCTGCCGCTGGACGCGTCAAGGGCAGGGAGGTAGCGGTGGCGGCCCTGGCATTCAACGACGCGGAGGTGCTGGTCGAGACGGTGACGGAGGCGGACCAGCGCGGCGACGCGGCGTCACTGGCGGCGGCGTACGACAAGAGTGCGTTGCGGAAGGTCTCCGGACCCGCGCCCATTCACCAAGCTGCCTCAAGCTCCAGTCTCCCCGATCAGGTCGCCAAGGAGCTCGCGACTCGCAGTGAAACAGTGACCCCTTGGTTCTGGGGCTTATGGACCTTGATAAAGTACCGTACGAGCCACAACTACTGCAACCCTGCTTGGCTGGGACCACGTATCGGCGACAAGTTGCTCATTTCCCTCATCATCCTGACTCTGTACCTCGGAGTGGGGGATAACATGGCACCGGACAACCTGGTTAACGTTCAGTCCAGTTTGTTCATGTGGGCTCTGCTGCCGGCCTTTGGCGCTGCGTCGTACGTGCCCGCCATCGTGCTAGAGCGCCGGTTGTTTGTCCGCGAGCGCTCTGACGGGCTGTATCGCGTTTTCACCTACCTGGCCGCCAAGCTGGTGGAGGAGCTGCTGCTGTCGCTGATCATCACACTCGCCTTCTCCGCCTACGTGTTCTACGGGGTGCAGCTGCAAGGCAGCTGGGTTGTGTTCTGGCTGGTATACTTTGTGGATCTCTCGGTGGGCATCGTGCTGGCCTACCTAGTGGCAGCTCTCTCGCCCAACATGGATGTGGCCAATGCCGCACTGCCGGGCTTTGTGGTCACACTGCTGTTCTTTGCTGGCCAACTCATGACGGTGGACTCCATCCCCGATTGGTGGCAGTGGTACTCGCGTATCGACTTCCTTCGCTACGCGTGGGGTGCGCTGATGCTGAACCAGTTCGAGGACCACAACGTCGAGTTTGCGGGCGGGAAGACGATCTTGGAGTATTACGGCTTGTTGGGAGCGGACAAGTGGACCTACGTGGGCTACCTGTCGCTGTTCTGGATCGTGTTCGCGACGCTGGCGCTGCTGGCGCTGACTTTCGTGCGCCACCAGAAGCGGTGA


Protein sequences

Name Description Sequence
107413 ABC-2 and Plant PDR ABC-type transporter family protein (best arabidopsis hit)

MSDTSMPDVVDVEAGMVAKSSVSDAAFFKRRSSSDNTSSANNVQAGLCILMKDLSYHVASNSQRGERAYLLKGVSAYLEPGQMTALMGPSGSGKTTLLDLLAGRKTVGKTEGHLSFGGSQPTKQFLRRYTGYVEQFDTLLGDLTVREMLMYTAELKRPMEEPLADKRREVEVLLQRLALSNCSDVKIGDPMSKGISAVQRFHFVSLPYLLIGIALISNPRVLFLDEPTSGLDSYTANEVMKVVRGLAADGTTIAATIHSPTAATFALFDRVMLLVRGQLVYFGPQGLPALQFAAAEWPSSTAASELLELHRRATVQQTATGGDGGVAAAGRVKGREVAVAALAFNDAEVLVETVTEADQRGDAASLAAAYDKSALRKVSGPAPIHQAASSSSLPDQVAKELATRSETVTPWFWGLWTLIKYRTSHNYCNPAWLGPRIGDKLLISLIILTLYLGVGDNMAPDNLVNVQSSLFMWALLPAFGAASYVPAIVLERRLFVRERSDGLYRVFTYLAAKLVEELLLSLIITLAFSAYVFYGVQLQGSWVVFWLVYFVDLSVGIVLAYLVAALSPNMDVANAALPGFVVTLLFFAGQLMTVDSIPDWWQWYSRIDFLRYAWGALMLNQFEDHNVEFAGGKTILEYYGLLGADKWTYVGYLSLFWIVFATLALLALTFVRHQKR*

Domains

Domain Start-End Description Sequence

superfamily: SSF52540
49-284 SSF52540

ILMKDLSYHVASNSQRGERAYLLKGVSAYLEPGQMTALMGPSGSGKTTLLDLLAGRKTVGKTEGHLSFGGSQPTKQFLRRYTGYVEQFDTLLGDLTVREMLMYTAELKRPMEEPLADKRREVEVLLQRLALSNCSDVKIGDPMSKGISAVQRFHFVSLPYLLIGIALISNPRVLFLDEPTSGLDSYTANEVMKVVRGLAADGTTIAATIHSPTAATFALFDRVMLLVRGQLVYFGP

ProfileScan: PS50893
IPR003439
49-301 ABC_TRANSPORTER_2
ABC transporter-like

ILMKDLSYHVASNSQRGERAYLLKGVSAYLEPGQMTALMGPSGSGKTTLLDLLAGRKTVGKTEGHLSFGGSQPTKQFLRRYTGYVEQFDTLLGDLTVREMLMYTAELKRPMEEPLADKRREVEVLLQRLALSNCSDVKIGDPMSKGISAVQRFHFVSLPYLLIGIALISNPRVLFLDEPTSGLDSYTANEVMKVVRGLAADGTTIAATIHSPTAATFALFDRVMLLVRGQLVYFGPQGLPALQFAAAEWPSST

Gene3D: G3DSA:3.40.50.300
51-284 G3DSA:3.40.50.300

MKDLSYHVASNSQRGERAYLLKGVSAYLEPGQMTALMGPSGSGKTTLLDLLAGRKTVGKTEGHLSFGGSQPTKQFLRRYTGYVEQFDTLLGDLTVREMLMYTAELKRPMEEPLADKRREVEVLLQRLALSNCSDVKIGDPMSKGISAVQRFHFVSLPYLLIGIALISNPRVLFLDEPTSGLDSYTANEVMKVVRGLAADGTTIAATIHSPTAATFALFDRVMLLVRGQLVYFGP

HMMPanther: PTHR19241
52-676 PTHR19241,ATP-BINDING CASSETTE TRANSPORTER

KDLSYHVASNSQRGERAYLLKGVSAYLEPGQMTALMGPSGSGKTTLLDLLAGRKTVGKTEGHLSFGGSQPTKQFLRRYTGYVEQFDTLLGDLTVREMLMYTAELKRPMEEPLADKRREVEVLLQRLALSNCSDVKIGDPMSKGISAVQRFHFVSLPYLLIGIALISNPRVLFLDEPTSGLDSYTANEVMKVVRGLAADGTTIAATIHSPTAATFALFDRVMLLVRGQLVYFGPQGLPALQFAAAEWPSSTAASELLELHRRATVQQTATGGDGGVAAAGRVKGREVAVAALAFNDAEVLVETVTEADQRGDAASLAAAYDKSALRKVSGPAPIHQAASSSSLPDQVAKELATRSETVTPWFWGLWTLIKYRTSHNYCNPAWLGPRIGDKLLISLIILTLYLGVGDNMAPDNLVNVQSSLFMWALLPAFGAASYVPAIVLERRLFVRERSDGLYRVFTYLAAKLVEELLLSLIITLAFSAYVFYGVQLQGSWVVFWLVYFVDLSVGIVLAYLVAALSPNMDVANAALPGFVVTLLFFAGQLMTVDSIPDWWQWYSRIDFLRYAWGALMLNQFEDHNVEFAGGKTILEYYGLLGADKWTYVGYLSLFWIVFATLALLALTFVRHQKR

HMMSmart: SM00382
IPR003593
80-278 AAA,NBS
AAA+ ATPase domain

PGQMTALMGPSGSGKTTLLDLLAGRKTVGKTEGHLSFGGSQPTKQFLRRYTGYVEQFDTLLGDLTVREMLMYTAELKRPMEEPLADKRREVEVLLQRLALSNCSDVKIGDPMSKGISAVQRFHFVSLPYLLIGIALISNPRVLFLDEPTSGLDSYTANEVMKVVRGLAADGTTIAATIHSPTAATFALFDRVMLLVRGQ

HMMPfam: PF00005
IPR003439
95-229 ABC_tran
ABC transporter-like

TTLLDLLAGRKTVGKTEGHLSFGGSQPTKQFLRRYTGYVEQFDTLLGDLTVREMLMYTAELKRPMEEPLADKRREVEVLLQRLALSNCSDVKIGDPMSKGISAVQRFHFVSLPYLLIGIALISNPRVLFLDEPTS

HMMPfam: PF01061
IPR013525
416-622 ABC2_membrane
ABC-2 type transporter

WTLIKYRTSHNYCNPAWLGPRIGDKLLISLIILTLYLGVGDNMAPDNLVNVQSSLFMWALLPAFGAASYVPAIVLERRLFVRERSDGLYRVFTYLAAKLVEELLLSLIITLAFSAYVFYGVQLQGSWVVFWLVYFVDLSVGIVLAYLVAALSPNMDVANAALPGFVVTLLFFAGQLMTVDSIPDWWQWYSRIDFLRYAWGALMLNQF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox