PRGDB00182745 (107045)

From PRG Wiki
Jump to: navigation, search
107045
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Ectocarpus siliculosus

Comment?

PAS domain-containing protein tyrosine kinase family protein (best arabidopsis hit)

DNA Sequence

ATGACCCGACATATTCGTCACATTGTTTACGATGTCAGCAAGATTGTGCGCAGCAGCGTTGCATCGGAAATAGTGCCCCGCCCAGCTGCCGGATTCTATGCAGCATGGAAAGCGCTTCGTATATGTCTAGCTCTGTTGCTTATACAGGGACATAATGTCTTCAGCGCCTGCAGAGGCAGCACGAAGGCCCATTTCGTATCCGGGACAGGTTTTTCGAGGCTGGGACAACACCGGCACGGCCGGCTGCTTGTCAGCAGCTCGGGAGTGGCAAATGTATCAGATGGCTCCCTCTTTGTGGCCGCCTTGCGGGATCCAGCTGTCAAACGTATCGTTCTCACATCTCCACTGGTCGATGTCCCGCCTGATACCTGGGAGGCGGTCGGCGGCAACCTGCCCATCCCCATTACCCGCAATTTGACGTTGGAAGGAGACGAGGCGGACTGGCCGCTCCTGCGCCTTCATTACGTTAGGGACGTGGTTCGGCTCATGGACACGGTCATCTGGGCTATCCGCTTCCTGTTCCTGGACGGTGCAAACGGCGACAACAACTATCGCGAACAGGGCAAGTTAGCTGACTTTACTCGCCTGGTGGTGTACACATGCATGCATACAGCCCGGAAAGCCACAGTGGAGCAGCTATTTCAAGTGCTGTTCATGTTGTTCGCTTCGGCTGCGGTTGATCCAGGACAGAGGCGACGGCCCCATCAGTTTATTGCACGTTCAGCCATGCATGGCAAACTGATTGACCGGTGTTGCGCAGGCTTTTCCTTCCTGGCTCCCACGTTGCCAAACCAAGAGTCAGAAATGCAGTTCGGGCCAGCAGCCATGTCAATGAGGTTCGGCTTCCCATCCAAATTGAAGCTGCAAACCGTTAAGGCAGTCGAGAGGCCGGCGAAATACCCGAATGCCAAACAGCTGGTCCTGCTGAATTACCACTATCCGGAGGTTGACTGCCGCAACGGGTCCTCCGTGCCGCCACTGCAACGGTGTTGGCCAGATGGTGGCTTCGTAGTGGAGATGGCTGGTAACGGCAACCGCATTGACCCGTCCTCAGACCAGCCCGTCCCCACCAACACCATATTCCTTCTTCAAAATGTCACCGTCCGGTCTGAACATCCCGTGAACATTACGTGCCTCACAAAGCAGCAGGCCGCGCCCCTAGTCTGCTATCAGGAAACTAAGCGCCAGTTTGAGAATGTTACGACGTCTTTCTTAGACGATTACCGACCAGATCCGCTGCTTCGGGCCCTTGATGGTAATGCCTCTTCACCGCAAGTGAAGCAGACGCAGCGGCAGGACAGCGCACCGCCGGCGGCAAGTGGCGCGGAGGAAGACCAGGCCCCCAGCCGTGCAGTGGTAGTAGGGGCTGTAGTGGCAGGGACCGTGGTTACCGTGTCCCTAGTCGCGTTGATGGTGGCTGCTGCAGCGCGCTCGAAGCGGCTGCAGGAATACTGCAAAGATGTTGGCGGCAGTCGCGCGATCATGAACATTCTTTCTTTTTTGACGAACAACTTCGGTCGCAGCTGCCTGCAGTTGAGAAGTTGCCCAGGCCCAGCCTCTCAGCTGAACATTACTGGTACTGCTTATGAGGACGGGAGCGGCGGACGCGGGGCCTCACCTGCGACCCCCCGTAACCACCTTCCCAAGTCAGGCGAGTCCGCCAAAGTTGCAGCGGAACCAGGGGAAGTGCAGCCTGGCGAGCAGGAGGAGGTGGTGGGCACCAGGCCGACCGTGGTGACGCATCTGGAACAGGCTGCTGTGGTCATTACCCTAGACACGCGGCCGCAACCCAACCTGGAGCTGCGTGTGCGGTTAGTGGACCCCGGCGCTGATGCTGAGGCTGGCAACAGCAGCAACAGTCCCACAGCAGGTGCCGTCACGGGTGTCGTACCCCTGCACTCGAAGGAGGAGGAGGTCAGCGGCAGTGGCAGCGGCAGTGCTGGTGGTGCACCTCCCTGTACTGGTAGCAGTGTGGTGGAGCTGTCTTCGGTGGTACGCGGCAAGGGCACCTTTGGTCGAGTGGTGGAAGGTACTTACCGGGGGCAGCAAGTGGCTGTGAAGCTTCTGGCCAGCGACGGGCCCTGGGGGTGCTCCGTCGAGGCCTTTGCCTCCAGCTTTGCGCAGGAAGTGCAGGTGCTGAGCCGCTGTTATCACCCAAATGTTGTGCGATTGCTGGCGGCCTGTGTGGAGTCGCCGCGGCTATGTTTGGTTCTGGAGCTTATGGAGACTTCTCTGGATTGCCTTATGTACGGAGACCCGACAGCCCCACCGATGCCGCTGCCTAAGGTGCTTCATATCGCCATATCCATTGCCAACGCGCTGGCCTACCTGCACCCCACCATCACTCACCGGGACCTCAAGCCTGCCAACGTGCTGCTCAACGACCCCCACAGCGACCGGCCCACAGTTAAGCTTGCGGACTTTGGGCTGTCTCGGCTTCGTGTGACGGTGGCTCCAACGGAGCATCCGAATGCGGGCACGCCCGCATACATGGCACCGGAGTGCTTCGACTTGCAAAACCGTCAGGTCACACATAAAGCGGACATGTTCGCGCTGGGTGTGCTGCTGTGGGAGATGCTGGCCTGCGAGAGGCCCTGGCCTGGAATGAGCCCGCTGGAAATCGGCCTGACGGTAGCGTTCAACGGTATGCGCCTTTCCCTGGATGAACTCCTGGCCTCCGAGCGCTGCCCATCCAAGCTGGGTCGTCTGCTGCTAGCCTGCTGGGAGACGGATCCTGACCGACGGCCAGCGGCTGCAGAGGCAATCAAGGAGCTGGCGTTGATCCTGCAGCAACCGCAGGAGCAGCAGCTGCAGCCACCATCCCTGGTCAACCCGCCTGCCCTGCAGCAAGGTCAGCAGCTCCGATGCGAACAGCAGCTGGCGCGCGGACCGCAGCAGTCCAATGTCCGGGCACAGCTCACGGATACCATCGAGGTGGACCTTTGGGGTGATTCCTCATCTTCCAATTCAGTCCCACAAACAGGAGGAGCGGCTCGAGGAGCAGCAGCAACAGTGGCCTAG


Protein sequences

Name Description Sequence
107045 PAS domain-containing protein tyrosine kinase family protein (best arabidopsis hit)

MTRHIRHIVYDVSKIVRSSVASEIVPRPAAGFYAAWKALRICLALLLIQGHNVFSACRGSTKAHFVSGTGFSRLGQHRHGRLLVSSSGVANVSDGSLFVAALRDPAVKRIVLTSPLVDVPPDTWEAVGGNLPIPITRNLTLEGDEADWPLLRLHYVRDVVRLMDTVIWAIRFLFLDGANGDNNYREQGKLADFTRLVVYTCMHTARKATVEQLFQVLFMLFASAAVDPGQRRRPHQFIARSAMHGKLIDRCCAGFSFLAPTLPNQESEMQFGPAAMSMRFGFPSKLKLQTVKAVERPAKYPNAKQLVLLNYHYPEVDCRNGSSVPPLQRCWPDGGFVVEMAGNGNRIDPSSDQPVPTNTIFLLQNVTVRSEHPVNITCLTKQQAAPLVCYQETKRQFENVTTSFLDDYRPDPLLRALDGNASSPQVKQTQRQDSAPPAASGAEEDQAPSRAVVVGAVVAGTVVTVSLVALMVAAAARSKRLQEYCKDVGGSRAIMNILSFLTNNFGRSCLQLRSCPGPASQLNITGTAYEDGSGGRGASPATPRNHLPKSGESAKVAAEPGEVQPGEQEEVVGTRPTVVTHLEQAAVVITLDTRPQPNLELRVRLVDPGADAEAGNSSNSPTAGAVTGVVPLHSKEEEVSGSGSGSAGGAPPCTGSSVVELSSVVRGKGTFGRVVEGTYRGQQVAVKLLASDGPWGCSVEAFASSFAQEVQVLSRCYHPNVVRLLAACVESPRLCLVLELMETSLDCLMYGDPTAPPMPLPKVLHIAISIANALAYLHPTITHRDLKPANVLLNDPHSDRPTVKLADFGLSRLRVTVAPTEHPNAGTPAYMAPECFDLQNRQVTHKADMFALGVLLWEMLACERPWPGMSPLEIGLTVAFNGMRLSLDELLASERCPSKLGRLLLACWETDPDRRPAAAEAIKELALILQQPQEQQLQPPSLVNPPALQQGQQLRCEQQLARGPQQSNVRAQLTDTIEVDLWGDSSSSNSVPQTGGAARGAAATVA*

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
660-927 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ELSSVVRGKGTFGRVVEGTYRGQQVAVKLLASDGPWGCSVEAFASSFAQEVQVLSRCYHPNVVRLLAACVESPRLCLVLELMETSLDCLMYGDPTAPPMPLPKVLHIAISIANALAYLHPTITHRDLKPANVLLNDPHSDRPTVKLADFGLSRLRVTVAPTEHPNAGTPAYMAPECFDLQNRQVTHKADMFALGVLLWEMLACERPWPGMSPLEIGLTVAFNGMRLSLDELLASERCPSKLGRLLLACWETDPDRRPAAAEAIKELAL

HMMPanther: PTHR23257:SF325
665-948 PTHR23257:SF325

VRGKGTFGRVVEGTYRGQQVAVKLLASDGPWGCSVEAFASSFAQEVQVLSRCYHPNVVRLLAACVESPRLCLVLELMETSLDCLMYGDPTAPPMPLPKVLHIAISIANALAYLHPTITHRDLKPANVLLNDPHSDRPTVKLADFGLSRLRVTVAPTEHPNAGTPAYMAPECFDLQNRQVTHKADMFALGVLLWEMLACERPWPGMSPLEIGLTVAFNGMRLSLDELLASERCPSKLGRLLLACWETDPDRRPAAAEAIKELALILQQPQEQQLQPPSLVNPPAL

HMMPanther: PTHR23257
665-948 PTHR23257,Ser-thr,SERINE-THREONINE PROTEIN KINASE

VRGKGTFGRVVEGTYRGQQVAVKLLASDGPWGCSVEAFASSFAQEVQVLSRCYHPNVVRLLAACVESPRLCLVLELMETSLDCLMYGDPTAPPMPLPKVLHIAISIANALAYLHPTITHRDLKPANVLLNDPHSDRPTVKLADFGLSRLRVTVAPTEHPNAGTPAYMAPECFDLQNRQVTHKADMFALGVLLWEMLACERPWPGMSPLEIGLTVAFNGMRLSLDELLASERCPSKLGRLLLACWETDPDRRPAAAEAIKELALILQQPQEQQLQPPSLVNPPAL

HMMPfam: PF00069
IPR000719
667-923 Pkinase,Ser-thr
Protein kinase, catalytic domain

GKGTFGRVVEGTYRGQQVAVKLLASDGPWGCSVEAFASSFAQEVQVLSRCYHPNVVRLLAACVESPRLCLVLELMETSLDCLMYGDPTAPPMPLPKVLHIAISIANALAYLHPTITHRDLKPANVLLNDPHSDRPTVKLADFGLSRLRVTVAPTEHPNAGTPAYMAPECFDLQNRQVTHKADMFALGVLLWEMLACERPWPGMSPLEIGLTVAFNGMRLSLDELLASERCPSKLGRLLLACWETDPDRRPAAAEAIK

superfamily: SSF56112
IPR011009
667-956 Kinase_like
Protein kinase-like domain

GKGTFGRVVEGTYRGQQVAVKLLASDGPWGCSVEAFASSFAQEVQVLSRCYHPNVVRLLAACVESPRLCLVLELMETSLDCLMYGDPTAPPMPLPKVLHIAISIANALAYLHPTITHRDLKPANVLLNDPHSDRPTVKLADFGLSRLRVTVAPTEHPNAGTPAYMAPECFDLQNRQVTHKADMFALGVLLWEMLACERPWPGMSPLEIGLTVAFNGMRLSLDELLASERCPSKLGRLLLACWETDPDRRPAAAEAIKELALILQQPQEQQLQPPSLVNPPALQQGQQLRC

Gene3D: G3DSA:3.30.200.20
667-742 G3DSA:3.30.200.20

GKGTFGRVVEGTYRGQQVAVKLLASDGPWGCSVEAFASSFAQEVQVLSRCYHPNVVRLLAACVESPRLCLVLELME

Gene3D: G3DSA:1.10.510.10
751-957 G3DSA:1.10.510.10

GDPTAPPMPLPKVLHIAISIANALAYLHPTITHRDLKPANVLLNDPHSDRPTVKLADFGLSRLRVTVAPTEHPNAGTPAYMAPECFDLQNRQVTHKADMFALGVLLWEMLACERPWPGMSPLEIGLTVAFNGMRLSLDELLASERCPSKLGRLLLACWETDPDRRPAAAEAIKELALILQQPQEQQLQPPSLVNPPALQQGQQLRCE

PatternScan: PS00108
IPR008271
781-793 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ITHRDLKPANVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox