PRGDB00182746 (107342)

From PRG Wiki
Jump to: navigation, search
107342
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class N
Domain Type Ser-Thr Kinase, NBS
Gene Species Ectocarpus siliculosus

Comment?

mitogen-activated protein kinase kinase kinase 7 (best arabidopsis hit)

DNA Sequence

ATGGCAAGCGGGAAAAAAGTCACGGACCGCTTCTATTTCTACGAGGAATTAGGCCGAGGAGCATATGGGCAGGTTTACAGGGGTGTGGACTCTCTGTCCGGTCAAGTTGTAGCAATTAAGCAGATCTCCCTTACTGGCATCCCGTCAGATAGCCTTCAGACGGTGATGGGAGAGATTGACCTCCTAAAGACGTTGAACCACAGAAACATCGTTAAATACATTGGTTCCTTCAAGTCGCGGACGCACTTGTACATTATTCTTGAATATATGGAGAATGGCTCGCTGGCCAGTATCATCAAGCCCAATAAGTTTGGGACCTTTTCCGAGAGCCTTGCTGCAGTCTACATAGCTCAAGTCTTGCAAGGTCTTCAGTACCTGCACGAGCAGGGCGTCGTTCACCGTGATATCAAAGGCGCCAACATTCTGACAACTAAGGATGTGGTCAAAGCAGCCCTGGACTTTTGCTGGCGTTGTTACCAGGGGCTGGTCAAATTGGCAGACTTTGGTGTCGCAGCGAAATTGGGCGAGCTAGATGAGCGAAAGGACGAGCTGGCAGCGTCGGTGGTGGGCACGCCGTACTGGATGGCGCCAGAGGTTATAGAGATGACCCAGGTGACAAGCAGCAGTGACATCTGGTCGGTTGGCTGCTTGATCATTGAACTCCTGACAGGCTACCCACCGTACTTCGACATGGTGCCCATGTCGGCGATGTTCAGGATTGTGAAGGACCCCCAACCTCCCTTGCCCGAGAGCATCACCCCGCTCCTGCGGGACTTTCTGTCCCTGTGCTTCCTTAAGGATGCCAAGTTGCGACCGGATGCAAAAACGCTTCTCCAGCACGAATGGATGCAGTATAATCGCCGCACCCTGCGGATGAGCTGGCGCCGGGACAGGGGCCAGACCTTTCGCACGCTCGTTCAGAACCGCACGGCGGCGCGGCAATCGCCAGATGCACACGAACACATTAGCAGCGTCGTCACGCGGATGATGGCCGCCGCGGACGAAGAGGTGTCTGGTGGCGACGCAGCGAATGCAAACGGTTTGGATAGCGTTTCGTCGGGGATGCTTGGCCCGTTAGGTGCAGGTGCGGCGGTACCGCTTGACAGGGGCTCCCAGGATCCGTCCGCATTGGGAGCTGGCGGTGACGGACGGATCAGCGGTAATGAGGCTGGTGTTCCAGCTGCGGCGCCAGCCGGTGAAGAACCGACAACCGCGTTGCTGGCAACTGCACCACAGTACAGTGACTCAACATCAGCGGCGGGCACGCCTGGGCGGTGCCGGGTGGAGTGCAGCCTGGTCCCCTCATGGGTCTCATCCAGAGGCTTCACGGCACGGCAGTTTGTGATGGAGCAGGGGCGCAAGGAAGGCCCAATCCACGCGACCTTGCGGGATGGATGGATGGCGGCGGGCAGGCGTATGATACGTTGGGCCATGTATCACGGCCTGCAGGCGCATGGCCTGGCGCAGACTCAAGTTCGAGACCTCGTCCAAAAGATGAGGCCGGGCGCACGGCAAGAGCCGCTAACCTCCAGAGAACCCTTAACCGCAAGAGAAGGACCTGCAACCAGCGCTGCAAAAGCCATTAAGGAACTCGAGCAGATGATCTCTGCGCCGGTGCCCCCTCCGCTCGCCTCACCCTCGGGCCCGTGGCAAGGGGTCGGGGAGGAGACCCAGCACCAGCCGGCGGAGGTGAAGGCCATGTTCCTGAGTGAGGGCGGCGTCCTTGTCATGATGGAGGTGCTGGATGCGGATAACCAGAAGGCGGTGGAGGCGGTCCTTGACCTGCTCATGGTGCTCATCCGTGAAGATGTACGCCTGCTGGAAAGTTTATGCTTGGTAGGCTTAGTGCCGGCAGTTACACGATACACGCAGCAGCCGTATCCCGTCAGCCTTCGTCTTAAGGCAGCCGCGTTCGTGCACTCCCTATGCTTCCAAGGAGACTCGACCTTGCAGTTATTCATTGCAGCCGGCGGCCTCCGGCAGCTTTGTTGGATGGTGGCGGACAGCGTCGCTTCGGAGCCGTCGCCACTGAGCCACGTCGCTATACAGTGCTTGCTGCAGTGGCCTGTCCTCCGGTGCTACAACACCCTGCCGCGCAACCATGTCTGCCGCATCCTGGCGCAATGCGGCCTGGTGCCCCGGTTGTATAAGCTACTGAAGGAGGCTATCCTGATGCGGAACAACTTGGTGCAACACCACGCTTCTCAGCCCGGTCGGGGCGCTGCCAACGCTGCGAACGGTGTTGGTGCCTCGGGGCCCCCGAATGCAGCACAGCAGGCCGATGGTGCTGCTGCTCATGCTTCGGGGGCCCACCATGTTCGGTCCGTTTCAACTGCACCCTTGCTATCTGAGGGGCCAGCACGGAGGGGCCCAGAGCCAGGCGTCGTGCCGGGCACGCCTGCCGGGGGTGGTGCTGTTGCTGGGGTGCACCGCACGGCAACGGCACCGTTGCTTGCCGGCGCGGGGTCGGGCAACTTGGGGACGGCTGTGGAGACGCGAGGCGCTGGCGGCATAGGTATTCCTGGTGAAACGCTGACTTATGAGCAGGTGCTGTACCTGATGGACGAAACGGTTCGATTGCTGGTGGTGCTGAGCAACGCCGATGGCGCCGTGAAGAGCGCGATGTGCACACGAGACAACCTGCTGCAGCACCTAGATTGTCTGCGACGCCTGCAGCCGCCGCACCTGGTCCAGATGCTTCACTGCATGCGCAACCTCACGAGCGATCCGGCGGTGCTGCCCGCTATCAAGGACGCCGGTGCCATTGCTTGCCTGGTCCCCATGCTGGCGCATGCTTCTGATGGTTCCGCTGCAAGCAATGCTGGCGCCGGTTCGGCCGCCACGGCCGGTGCAGCGTCCAGCGGATCAGGGGCATCTACGGGTCCAGGGACCAATATTCTGAACGCCGCTGGTGTACTGCCCAAGAGTGAGGTCCAAATGGAGGCGCTGAATGCACTGTATAATCTTTGCATGTACAATAAAAAGGTCCATATGGAAGCTGCGGCTTCATCCAACATTATCCCGCATCTCTGCTCGTTTGCCGCTCAAGCCCTTGCAGCAGCCGCGGCACAGTGGCCCACCGTCCGCGGATTCGTTGTTCCTATGCTACTGGGAATGGTCTACTGCAGCGCCAATACTCGCATGAAGCTATTCCAGAGCCACGGCCTTGAGATCTTCCTACAGCTGCTATCCAATGAGGACAGCCGCAGCGTGCTGGGCGTGCTGCAAGCTCTGGACAGCTGGCTAGCGGAGGACCACAACCGTGTGGAGGCACGGCTGACGCAGCGGGACGCGGTTACGCACCTGGTGCAGTTATACTCCAGGAGCTGCGCGGCGCAGGACATGCAATCCAAGCTTGAGACACTGCGGACCATGCTGGGCCGGTCGTCGAAGCTCGCGGTGGCGCTCGCGATGGGCGGCCTTGTGCCCTGGCTGCTGGCCATGATTCAGCACGCCGCGCCCATCAACCGCGTCAAGATTTTGGATATTGTCAGGATACTGTACGAGCACTATCCTCGGCCCAAGGAGTTTATCATGATGTATAAGATTCAAGACATCCTGGCCGCGCTGCTCAAGACACATGGCCGGGATGCAGATGCCGTAATTCAGCAGGCGCAGCGACTTTTGGCTGCCTTTGACATTAACGTGCTCCTGATTTCGTGGTTTTGCAGCCTTCGTGGTAATGAGTTCTTCTGCGAGGTTGACGAGGAATACATAGAGGATGACTTCAATTTGTCGGGGCTTAGCTCGCAAGTGCCCTACTATGAATATGCACTGGATATGATACTGGATAACGAGCCCCCCCACGATGTGATGCTCACGGACCAGCAGCACGAGCTGCTTGAGAGCGCAGCAGAGATGCTGTATGGGCTCATACATGCAAGGTATATTGTCACGGCCCGGGGGTTGGCGTGCATGCTTGAGAAGTTCAAGAACTACGAATTCGGCAGGTGCCCCCGCTTCTATTGCGAGGGGCAGGCCTGTCTCCCGGTCGGCACGTCGGACGTGCCGGGGCAATCAACTGTGAAAATTTTCTGCCCGAAGTGCGAGGACATTTTCTACCCGCGCTCCGAGTATCAGTGCAGCATTGACGGGGCGTACTTCGGTACGACTTTCCCACATCTGCTACTTATGACCTACCCTATGTACAGGCCGCCCAAGAGCATGGAGCAGTATGTGCCGCGCATTTTTGGCTTTAAGCTGCACCCCACGGCGTACGGCAATCGAGAGCCGGCGATGGCGCGAACTAACCAGCGGAGGATAGCAGCACGGGAAGCAAATCCGAAGGACGGTCAGCAAAAGCAAGAAGACGATAGCTTGTAA


Protein sequences

Name Description Sequence
107342 mitogen-activated protein kinase kinase kinase 7 (best arabidopsis hit)

MASGKKVTDRFYFYEELGRGAYGQVYRGVDSLSGQVVAIKQISLTGIPSDSLQTVMGEIDLLKTLNHRNIVKYIGSFKSRTHLYIILEYMENGSLASIIKPNKFGTFSESLAAVYIAQVLQGLQYLHEQGVVHRDIKGANILTTKDVVKAALDFCWRCYQGLVKLADFGVAAKLGELDERKDELAASVVGTPYWMAPEVIEMTQVTSSSDIWSVGCLIIELLTGYPPYFDMVPMSAMFRIVKDPQPPLPESITPLLRDFLSLCFLKDAKLRPDAKTLLQHEWMQYNRRTLRMSWRRDRGQTFRTLVQNRTAARQSPDAHEHISSVVTRMMAAADEEVSGGDAANANGLDSVSSGMLGPLGAGAAVPLDRGSQDPSALGAGGDGRISGNEAGVPAAAPAGEEPTTALLATAPQYSDSTSAAGTPGRCRVECSLVPSWVSSRGFTARQFVMEQGRKEGPIHATLRDGWMAAGRRMIRWAMYHGLQAHGLAQTQVRDLVQKMRPGARQEPLTSREPLTAREGPATSAAKAIKELEQMISAPVPPPLASPSGPWQGVGEETQHQPAEVKAMFLSEGGVLVMMEVLDADNQKAVEAVLDLLMVLIREDVRLLESLCLVGLVPAVTRYTQQPYPVSLRLKAAAFVHSLCFQGDSTLQLFIAAGGLRQLCWMVADSVASEPSPLSHVAIQCLLQWPVLRCYNTLPRNHVCRILAQCGLVPRLYKLLKEAILMRNNLVQHHASQPGRGAANAANGVGASGPPNAAQQADGAAAHASGAHHVRSVSTAPLLSEGPARRGPEPGVVPGTPAGGGAVAGVHRTATAPLLAGAGSGNLGTAVETRGAGGIGIPGETLTYEQVLYLMDETVRLLVVLSNADGAVKSAMCTRDNLLQHLDCLRRLQPPHLVQMLHCMRNLTSDPAVLPAIKDAGAIACLVPMLAHASDGSAASNAGAGSAATAGAASSGSGASTGPGTNILNAAGVLPKSEVQMEALNALYNLCMYNKKVHMEAAASSNIIPHLCSFAAQALAAAAAQWPTVRGFVVPMLLGMVYCSANTRMKLFQSHGLEIFLQLLSNEDSRSVLGVLQALDSWLAEDHNRVEARLTQRDAVTHLVQLYSRSCAAQDMQSKLETLRTMLGRSSKLAVALAMGGLVPWLLAMIQHAAPINRVKILDIVRILYEHYPRPKEFIMMYKIQDILAALLKTHGRDADAVIQQAQRLLAAFDINVLLISWFCSLRGNEFFCEVDEEYIEDDFNLSGLSSQVPYYEYALDMILDNEPPHDVMLTDQQHELLESAAEMLYGLIHARYIVTARGLACMLEKFKNYEFGRCPRFYCEGQACLPVGTSDVPGQSTVKIFCPKCEDIFYPRSEYQCSIDGAYFGTTFPHLLLMTYPMYRPPKSMEQYVPRIFGFKLHPTAYGNREPAMARTNQRRIAAREANPKDGQQKQEDDSL*

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
4-284 Kinase_like
Protein kinase-like domain

GKKVTDRFYFYEELGRGAYGQVYRGVDSLSGQVVAIKQISLTGIPSDSLQTVMGEIDLLKTLNHRNIVKYIGSFKSRTHLYIILEYMENGSLASIIKPNKFGTFSESLAAVYIAQVLQGLQYLHEQGVVHRDIKGANILTTKDVVKAALDFCWRCYQGLVKLADFGVAAKLGELDERKDELAASVVGTPYWMAPEVIEMTQVTSSSDIWSVGCLIIELLTGYPPYFDMVPMSAMFRIVKDPQPPLPESITPLLRDFLSLCFLKDAKLRPDAKTLLQHEWMQ

Gene3D: G3DSA:3.30.200.20
4-120 G3DSA:3.30.200.20

GKKVTDRFYFYEELGRGAYGQVYRGVDSLSGQVVAIKQISLTGIPSDSLQTVMGEIDLLKTLNHRNIVKYIGSFKSRTHLYIILEYMENGSLASIIKPNKFGTFSESLAAVYIAQVL

ProfileScan: PS50011
IPR000719
11-283 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FYFYEELGRGAYGQVYRGVDSLSGQVVAIKQISLTGIPSDSLQTVMGEIDLLKTLNHRNIVKYIGSFKSRTHLYIILEYMENGSLASIIKPNKFGTFSESLAAVYIAQVLQGLQYLHEQGVVHRDIKGANILTTKDVVKAALDFCWRCYQGLVKLADFGVAAKLGELDERKDELAASVVGTPYWMAPEVIEMTQVTSSSDIWSVGCLIIELLTGYPPYFDMVPMSAMFRIVKDPQPPLPESITPLLRDFLSLCFLKDAKLRPDAKTLLQHEWM

HMMSmart: SM00220
IPR002290
11-283 S_TKc
Serine/threonine- / dual-specificity protein kinas

FYFYEELGRGAYGQVYRGVDSLSGQVVAIKQISLTGIPSDSLQTVMGEIDLLKTLNHRNIVKYIGSFKSRTHLYIILEYMENGSLASIIKPNKFGTFSESLAAVYIAQVLQGLQYLHEQGVVHRDIKGANILTTKDVVKAALDFCWRCYQGLVKLADFGVAAKLGELDERKDELAASVVGTPYWMAPEVIEMTQVTSSSDIWSVGCLIIELLTGYPPYFDMVPMSAMFRIVKDPQPPLPESITPLLRDFLSLCFLKDAKLRPDAKTLLQHEWM

HMMPfam: PF00069
IPR000719
14-283 Pkinase,Ser-thr
Protein kinase, catalytic domain

YEELGRGAYGQVYRGVDSLSGQVVAIKQISLTGIPSDSLQTVMGEIDLLKTLNHRNIVKYIGSFKSRTHLYIILEYMENGSLASIIKPNKFGTFSESLAAVYIAQVLQGLQYLHEQGVVHRDIKGANILTTKDVVKAALDFCWRCYQGLVKLADFGVAAKLGELDERKDELAASVVGTPYWMAPEVIEMTQVTSSSDIWSVGCLIIELLTGYPPYFDMVPMSAMFRIVKDPQPPLPESITPLLRDFLSLCFLKDAKLRPDAKTLLQHEWM

HMMPanther: PTHR24361
15-293 PTHR24361,MITOGEN-ACTIVATED KINASE KINASE KINASE

EELGRGAYGQVYRGVDSLSGQVVAIKQISLTGIPSDSLQTVMGEIDLLKTLNHRNIVKYIGSFKSRTHLYIILEYMENGSLASIIKPNKFGTFSESLAAVYIAQVLQGLQYLHEQGVVHRDIKGANILTTKDVVKAALDFCWRCYQGLVKLADFGVAAKLGELDERKDELAASVVGTPYWMAPEVIEMTQVTSSSDIWSVGCLIIELLTGYPPYFDMVPMSAMFRIVKDPQPPLPESITPLLRDFLSLCFLKDAKLRPDAKTLLQHEWMQYNRRTLRMS

HMMPanther: PTHR24361:SF61
15-293 PTHR24361:SF61,NIK-RELATED PROTEIN KINASE

EELGRGAYGQVYRGVDSLSGQVVAIKQISLTGIPSDSLQTVMGEIDLLKTLNHRNIVKYIGSFKSRTHLYIILEYMENGSLASIIKPNKFGTFSESLAAVYIAQVLQGLQYLHEQGVVHRDIKGANILTTKDVVKAALDFCWRCYQGLVKLADFGVAAKLGELDERKDELAASVVGTPYWMAPEVIEMTQVTSSSDIWSVGCLIIELLTGYPPYFDMVPMSAMFRIVKDPQPPLPESITPLLRDFLSLCFLKDAKLRPDAKTLLQHEWMQYNRRTLRMS

PatternScan: PS00107
IPR017441
17-40 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGAYGQVYRGVDSLSGQVVAIK

Gene3D: G3DSA:1.10.510.10
121-286 G3DSA:1.10.510.10

QGLQYLHEQGVVHRDIKGANILTTKDVVKAALDFCWRCYQGLVKLADFGVAAKLGELDERKDELAASVVGTPYWMAPEVIEMTQVTSSSDIWSVGCLIIELLTGYPPYFDMVPMSAMFRIVKDPQPPLPESITPLLRDFLSLCFLKDAKLRPDAKTLLQHEWMQYN

PatternScan: PS00108
IPR008271
131-143 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VVHRDIKGANILT

Gene3D: G3DSA:1.25.10.10
IPR011989
563-718 ARM-like
Armadillo-like helical

EVKAMFLSEGGVLVMMEVLDADNQKAVEAVLDLLMVLIREDVRLLESLCLVGLVPAVTRYTQQPYPVSLRLKAAAFVHSLCFQGDSTLQLFIAAGGLRQLCWMVADSVASEPSPLSHVAIQCLLQWPVLRCYNTLPRNHVCRILAQCGLVPRLYKL

superfamily: SSF48371
IPR016024
574-1212 ARM-type_fold,NBS
Armadillo-type fold

VLVMMEVLDADNQKAVEAVLDLLMVLIREDVRLLESLCLVGLVPAVTRYTQQPYPVSLRLKAAAFVHSLCFQGDSTLQLFIAAGGLRQLCWMVADSVASEPSPLSHVAIQCLLQWPVLRCYNTLPRNHVCRILAQCGLVPRLYKLLKEAILMRNNLVQHHASQPGRGAANAANGVGASGPPNAAQQADGAAAHASGAHHVRSVSTAPLLSEGPARRGPEPGVVPGTPAGGGAVAGVHRTATAPLLAGAGSGNLGTAVETRGAGGIGIPGETLTYEQVLYLMDETVRLLVVLSNADGAVKSAMCTRDNLLQHLDCLRRLQPPHLVQMLHCMRNLTSDPAVLPAIKDAGAIACLVPMLAHASDGSAASNAGAGSAATAGAASSGSGASTGPGTNILNAAGVLPKSEVQMEALNALYNLCMYNKKVHMEAAASSNIIPHLCSFAAQALAAAAAQWPTVRGFVVPMLLGMVYCSANTRMKLFQSHGLEIFLQLLSNEDSRSVLGVLQALDSWLAEDHNRVEARLTQRDAVTHLVQLYSRSCAAQDMQSKLETLRTMLGRSSKLAVALAMGGLVPWLLAMIQHAAPINRVKILDIVRILYEHYPRPKEFIMMYKIQDILAALLKTHGRDADAVIQQAQRLLAAF

Gene3D: G3DSA:1.25.10.10
IPR011989
888-931 ARM-like
Armadillo-like helical

LRRLQPPHLVQMLHCMRNLTSDPAVLPAIKDAGAIACLVPMLAH

Gene3D: G3DSA:1.25.10.10
IPR011989
974-1107 ARM-like
Armadillo-like helical

PKSEVQMEALNALYNLCMYNKKVHMEAAASSNIIPHLCSFAAQALAAAAAQWPTVRGFVVPMLLGMVYCSANTRMKLFQSHGLEIFLQLLSNEDSRSVLGVLQALDSWLAEDHNRVEARLTQRDAVTHLVQLYS

superfamily: SSF57798
IPR000704
1215-1414 Casein_kinase_II_reg-sub
Casein kinase II, regulatory subunit

NVLLISWFCSLRGNEFFCEVDEEYIEDDFNLSGLSSQVPYYEYALDMILDNEPPHDVMLTDQQHELLESAAEMLYGLIHARYIVTARGLACMLEKFKNYEFGRCPRFYCEGQACLPVGTSDVPGQSTVKIFCPKCEDIFYPRSEYQCSIDGAYFGTTFPHLLLMTYPMYRPPKSMEQYVPRIFGFKLHPTAYGNREPAMA

HMMSmart: SM01085
IPR000704
1217-1400 CK_II_beta
Casein kinase II, regulatory subunit

LLISWFCSLRGNEFFCEVDEEYIEDDFNLSGLSSQVPYYEYALDMILDNEPPHDVMLTDQQHELLESAAEMLYGLIHARYIVTARGLACMLEKFKNYEFGRCPRFYCEGQACLPVGTSDVPGQSTVKIFCPKCEDIFYPRSEYQCSIDGAYFGTTFPHLLLMTYPMYRPPKSMEQYVPRIFGFK

FPrintScan: PR00472
IPR000704
1217-1233 CASNKINASEII
Casein kinase II, regulatory subunit

LLISWFCSLRGNEFFCE

Gene3D: G3DSA:1.10.1820.10
IPR016149
1219-1315 Casein_kin_II_reg-sub_a-hlx
Casein kinase II, regulatory subunit, alpha-helica

ISWFCSLRGNEFFCEVDEEYIEDDFNLSGLSSQVPYYEYALDMILDNEPPHDVMLTDQQHELLESAAEMLYGLIHARYIVTARGLACMLEKFKNYEF

HMMPfam: PF01214
IPR000704
1219-1400 CK_II_beta
Casein kinase II, regulatory subunit

ISWFCSLRGNEFFCEVDEEYIEDDFNLSGLSSQVPYYEYALDMILDNEPPHDVMLTDQQHELLESAAEMLYGLIHARYIVTARGLACMLEKFKNYEFGRCPRFYCEGQACLPVGTSDVPGQSTVKIFCPKCEDIFYPRSEYQCSIDGAYFGTTFPHLLLMTYPMYRPPKSMEQYVPRIFGFK

FPrintScan: PR00472
IPR000704
1234-1248 CASNKINASEII
Casein kinase II, regulatory subunit

VDEEYIEDDFNLSGL

FPrintScan: PR00472
IPR000704
1289-1310 CASNKINASEII
Casein kinase II, regulatory subunit

YGLIHARYIVTARGLACMLEKF

FPrintScan: PR00472
IPR000704
1314-1335 CASNKINASEII
Casein kinase II, regulatory subunit

EFGRCPRFYCEGQACLPVGTSD

Gene3D: G3DSA:2.20.25.20
IPR016150
1316-1387 Casein_kin_II_reg-sub_b-sht
Casein kinase II, regulatory subunit, beta-sheet

GRCPRFYCEGQACLPVGTSDVPGQSTVKIFCPKCEDIFYPRSEYQCSIDGAYFGTTFPHLLLMTYPMYRPPK

FPrintScan: PR00472
IPR000704
1336-1357 CASNKINASEII
Casein kinase II, regulatory subunit

VPGQSTVKIFCPKCEDIFYPRS

FPrintScan: PR00472
IPR000704
1364-1381 CASNKINASEII
Casein kinase II, regulatory subunit

DGAYFGTTFPHLLLMTYP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox