PRGDB00182773 (105948)

From PRG Wiki
Jump to: navigation, search
105948
Gene Type Putative_R-Genes,_predicted_from_Pythozome
GenBank
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Ectocarpus siliculosus

Comment?

ataurora3 (best arabidopsis hit)

DNA Sequence

ATGTGCATGCGCAGGCGGATTGACCAATTTCATTTATTGCGGAAAGTTGGCAGCGGGTATGCCAGCACAGTGTACTTGGGCACTTGTCGCACAACTGGAAACCAAGTCGCGGTGAAACTCTATCACAAGAATAAGCTATCCGAACTTAATCATTATCAAGTGGCGCGTGAGATTACTATCCATAGCGGCCTTGATCACAAGCATATTATCCAGCTGTGGGCGGCCTTTGAGGACCAGTATGGTATCTACCTTGTGTTTGAGTACGCAAGCAAGGGCGATGTTTTCACTGAGGTGGAGCGCCGAGGTGGGCAACTCAATGAAGCAGAATCCGTGCGACAGGTGATATACCCTTTCCTCAGCGCGCTGGACTACCTCCACAGCAACTACATCATCCATCGCGATATTAAGCCGGAAAATCTCTTATTTACGGCCACTGGCGTCCTCAAAGTTGGAGATTTCGGGTTGTCCATCAACTTCAGCCAGGAGCGACCCGTCACCCGGGTGGGCACCCTGGACTACATGGCGCCCGAGGTGGTGGTGTGTCCGGATAAGCACCGGCCGCAGGATCACAAGGAGCTGAAGCACCTGCATTACACACCGTTGGTAGACGCCTGGGCGGTGGGGGTACTAGCCTACGAACTGATTGTGGGGCGGCCGCCTTTCGACAAGGGGCAGAAGAAGGCGACCATCCACGAGATTCTGAACGGGGAGCCCTTCATTCCGCCCTGGTTGTCGGAAGGCGCTGTCCACTTCATCAAGTGGGCTCTCACGAAGGAAGTGAGCAAGCGGCCCTCGGTGCAGCAGCTCTCGGAGCATCCCTGGATCACCAGCCACACGAAACAAGCGGTGCTGGCGACAGCGAGGCGACAGCTGATCAAGACAGACTCGTTCGTAGAGCCCCGGCAGCTGGGCTTCCGCGGGAGCAACATGCCCGTAGAGCCCCCCAGCACGAGCAGCAAGGAGCCGCCACGGACACTGCAGGTTGCGTCCGTGTCCCAGGGCGGCCGCCAGCTGGGCCACTCTAACTCCATGTCCGCAGTAGACGGCATGCGCTATCGCGATGTCAACATCGATAGCGTGACGAATGGCATGGCATCCACAGCGGCATCGGCCCTGAACGCTGTCAAACGCGTCTCCGATGGTGACGGCACCACGGGCGGACGGCCGAGTGCCGCTGGCGGCCGAGTTAGCCGCGCGGGAACTGCCCGGAATAGCGGAGCTGGCGGGGCCCCAGCAAACCGCTCAGGAAACCTGAATGTAGCTGCTGCGGCGGCTGCCCTGGCTGCCGTGGCGTCAGATGAGATACCGAGAAATGGCCGCCCAATGAGCCGGGAGGAGCTTATGTCATCCCTTTCGGCGCCCATGGGAGGGAGGAGTTTACAGATGATGCGTTCGTTCACGGCTGGGCGGCCAAATCTGGTGGTGCAGTCGGCAGCGCAGCAAGGCATGCGTACAAGCAGCAGCGGCAGCGCGGGCGCTGCATCGTCAGCAGTCAGTGGGTCGGTGACCGCGCATGGTATGCGGGTACACCCGCCGACGATGTCGCCGCTGGCGCGCACCGCCAGCGCCGCCTCGCAGGACTGGGGCCAGCTGCACCAGTCCCCACCTCCCCTCCCGTTCAGCAACGCTACCGCCAGCGCTGATCTGGCATTGGAAATGAGCCGCGTGCACGTTGACGCCAGCACCTCCGTCGCTAGCTCTACTACCGCGCCCTACAGCCCCAAGCCGAACACTCCCCTGCGGCCCCAGCCGCCTCAGGCGCCCTCGCCCTCCGCCCGGGGTCTGAAGAGCGGCTCGCCCCTCATTCCAAGTCGCTTGTCGCAGTCCTTCACCAGCTCCATCTCACCGCTCGCAGCGGCAGCAGCGGCGGCAGCTGTCGCCGCTGCCGGGGGCGCGGCGCCAACGTCGCAGCACACGCCTAGCAGGCTTGGCCAGCTGTCGAGCTCAGGTGTTGCGAACTCGGAAGCAGTGGCCGCGGCCCCAGCGGCATCGAAGGCGCCAGGTGTGCCTGCACTGGATGCCGTCGCGGGTCAGGAGGTCAGAGAGGCGGTTGGCGCAGAGGGATGTTCCGGTTCACCCGTGGTGCCTTCGGTGTCGGCAGTCTCCAGCAAGGGGACTGCTTCCGGCAGCGAGGCCGCGCTCAGCGTGGTGGCCAGCAGTAGCAGCGACCAATCCAGCCCCTCGCCGGCGGTCCCGTCCTCTGTCAGCCCGCTGGAGCTTCTTGGCGAAAGGGGTTTAGCAGCAGCAGCAGCAGTGCACTGTTCAGAGGAGGCTCTTAAGACGCGGGCAGGGTTGATCGCTCTGCGTAAGCACAAGCCGTAA


Protein sequences

Name Description Sequence
105948 ataurora3 (best arabidopsis hit)

MCMRRRIDQFHLLRKVGSGYASTVYLGTCRTTGNQVAVKLYHKNKLSELNHYQVAREITIHSGLDHKHIIQLWAAFEDQYGIYLVFEYASKGDVFTEVERRGGQLNEAESVRQVIYPFLSALDYLHSNYIIHRDIKPENLLFTATGVLKVGDFGLSINFSQERPVTRVGTLDYMAPEVVVCPDKHRPQDHKELKHLHYTPLVDAWAVGVLAYELIVGRPPFDKGQKKATIHEILNGEPFIPPWLSEGAVHFIKWALTKEVSKRPSVQQLSEHPWITSHTKQAVLATARRQLIKTDSFVEPRQLGFRGSNMPVEPPSTSSKEPPRTLQVASVSQGGRQLGHSNSMSAVDGMRYRDVNIDSVTNGMASTAASALNAVKRVSDGDGTTGGRPSAAGGRVSRAGTARNSGAGGAPANRSGNLNVAAAAAALAAVASDEIPRNGRPMSREELMSSLSAPMGGRSLQMMRSFTAGRPNLVVQSAAQQGMRTSSSGSAGAASSAVSGSVTAHGMRVHPPTMSPLARTASAASQDWGQLHQSPPPLPFSNATASADLALEMSRVHVDASTSVASSTTAPYSPKPNTPLRPQPPQAPSPSARGLKSGSPLIPSRLSQSFTSSISPLAAAAAAAAVAAAGGAAPTSQHTPSRLGQLSSSGVANSEAVAAAPAASKAPGVPALDAVAGQEVREAVGAEGCSGSPVVPSVSAVSSKGTASGSEAALSVVASSSSDQSSPSPAVPSSVSPLELLGERGLAAAAAVHCSEEALKTRAGLIALRKHKP*

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24349:SF101
3-299 PTHR24349:SF101

MRRRIDQFHLLRKVGSGYASTVYLGTCRTTGNQVAVKLYHKNKLSELNHYQVAREITIHSGLDHKHIIQLWAAFEDQYGIYLVFEYASKGDVFTEVERRGGQLNEAESVRQVIYPFLSALDYLHSNYIIHRDIKPENLLFTATGVLKVGDFGLSINFSQERPVTRVGTLDYMAPEVVVCPDKHRPQDHKELKHLHYTPLVDAWAVGVLAYELIVGRPPFDKGQKKATIHEILNGEPFIPPWLSEGAVHFIKWALTKEVSKRPSVQQLSEHPWITSHTKQAVLATARRQLIKTDSFVE

HMMPanther: PTHR24349
3-299 PTHR24349,SERINE/THREONINE-PROTEIN KINASE

MRRRIDQFHLLRKVGSGYASTVYLGTCRTTGNQVAVKLYHKNKLSELNHYQVAREITIHSGLDHKHIIQLWAAFEDQYGIYLVFEYASKGDVFTEVERRGGQLNEAESVRQVIYPFLSALDYLHSNYIIHRDIKPENLLFTATGVLKVGDFGLSINFSQERPVTRVGTLDYMAPEVVVCPDKHRPQDHKELKHLHYTPLVDAWAVGVLAYELIVGRPPFDKGQKKATIHEILNGEPFIPPWLSEGAVHFIKWALTKEVSKRPSVQQLSEHPWITSHTKQAVLATARRQLIKTDSFVE

superfamily: SSF56112
IPR011009
3-302 Kinase_like
Protein kinase-like domain

MRRRIDQFHLLRKVGSGYASTVYLGTCRTTGNQVAVKLYHKNKLSELNHYQVAREITIHSGLDHKHIIQLWAAFEDQYGIYLVFEYASKGDVFTEVERRGGQLNEAESVRQVIYPFLSALDYLHSNYIIHRDIKPENLLFTATGVLKVGDFGLSINFSQERPVTRVGTLDYMAPEVVVCPDKHRPQDHKELKHLHYTPLVDAWAVGVLAYELIVGRPPFDKGQKKATIHEILNGEPFIPPWLSEGAVHFIKWALTKEVSKRPSVQQLSEHPWITSHTKQAVLATARRQLIKTDSFVEPRQ

Gene3D: G3DSA:3.30.200.20
5-121 G3DSA:3.30.200.20

RRIDQFHLLRKVGSGYASTVYLGTCRTTGNQVAVKLYHKNKLSELNHYQVAREITIHSGLDHKHIIQLWAAFEDQYGIYLVFEYASKGDVFTEVERRGGQLNEAESVRQVIYPFLSA

ProfileScan: PS50011
IPR000719
10-275 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FHLLRKVGSGYASTVYLGTCRTTGNQVAVKLYHKNKLSELNHYQVAREITIHSGLDHKHIIQLWAAFEDQYGIYLVFEYASKGDVFTEVERRGGQLNEAESVRQVIYPFLSALDYLHSNYIIHRDIKPENLLFTATGVLKVGDFGLSINFSQERPVTRVGTLDYMAPEVVVCPDKHRPQDHKELKHLHYTPLVDAWAVGVLAYELIVGRPPFDKGQKKATIHEILNGEPFIPPWLSEGAVHFIKWALTKEVSKRPSVQQLSEHPWI

HMMSmart: SM00220
IPR002290
10-275 S_TKc
Serine/threonine- / dual-specificity protein kinas

FHLLRKVGSGYASTVYLGTCRTTGNQVAVKLYHKNKLSELNHYQVAREITIHSGLDHKHIIQLWAAFEDQYGIYLVFEYASKGDVFTEVERRGGQLNEAESVRQVIYPFLSALDYLHSNYIIHRDIKPENLLFTATGVLKVGDFGLSINFSQERPVTRVGTLDYMAPEVVVCPDKHRPQDHKELKHLHYTPLVDAWAVGVLAYELIVGRPPFDKGQKKATIHEILNGEPFIPPWLSEGAVHFIKWALTKEVSKRPSVQQLSEHPWI

HMMPfam: PF00069
IPR000719
10-275 Pkinase,Ser-thr
Protein kinase, catalytic domain

FHLLRKVGSGYASTVYLGTCRTTGNQVAVKLYHKNKLSELNHYQVAREITIHSGLDHKHIIQLWAAFEDQYGIYLVFEYASKGDVFTEVERRGGQLNEAESVRQVIYPFLSALDYLHSNYIIHRDIKPENLLFTATGVLKVGDFGLSINFSQERPVTRVGTLDYMAPEVVVCPDKHRPQDHKELKHLHYTPLVDAWAVGVLAYELIVGRPPFDKGQKKATIHEILNGEPFIPPWLSEGAVHFIKWALTKEVSKRPSVQQLSEHPWI

Gene3D: G3DSA:1.10.510.10
122-282 G3DSA:1.10.510.10

LDYLHSNYIIHRDIKPENLLFTATGVLKVGDFGLSINFSQERPVTRVGTLDYMAPEVVVCPDKHRPQDHKELKHLHYTPLVDAWAVGVLAYELIVGRPPFDKGQKKATIHEILNGEPFIPPWLSEGAVHFIKWALTKEVSKRPSVQQLSEHPWITSHTKQA

PatternScan: PS00108
IPR008271
130-142 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKPENLLF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox