PRGDB00186568 ()

From PRG Wiki
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

DNA Sequence


Protein sequences

Name Description Sequence
Probable disease resistance protein At1g58390 RecName: Full=Probable disease resistance protein At1g58390.

MAGELVSFGIKKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLRVLDLFYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFIFVPDVFMRMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWHSSSKDLCGMTRLMTLAIRLTRVTSTETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHLKHLLLDLYMPRQQHFPSRLTFVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSLELVMLGTRWKKKFSVGGEDYYKVQHIPSVEFIGGYLK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF233
2-902 PTHR23155:SF233,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

AGELVSFGIKKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLRVLDLFYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFIFVPDVFMRMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWHSSSKDLCGMTRLMTLAIRLTRVTSTETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHLKHLLLDLYMPRQQHFPSRLTFVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSLELVMLGTRWKKKFSVGGEDYYKVQHIPSVEFI

HMMPanther: PTHR23155
2-902 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AGELVSFGIKKLWDLLSQECEQFQGVEDQVTGLKRDLNLLSSFLKDADAKKHTTAVVRNVVEEIKEIVYDAEDIIETYLLKEKLWKTSGIKMRIRRHACIISDRRRNALDVGGIRTRISDVIRDMQSFGVQQAIVDGGYMQPQGDRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAEDYHNGETIQDVGQSYLEELVRRNMIIWERDATASRFGTCHLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLRVLDLFYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFIFVPDVFMRMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWHSSSKDLCGMTRLMTLAIRLTRVTSTETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHLKHLLLDLYMPRQQHFPSRLTFVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSLELVMLGTRWKKKFSVGGEDYYKVQHIPSVEFI

superfamily: SSF52540
146-398 SSF52540

DRQREMRQTFSKDYESDFVGLEVNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRT

HMMPfam: PF00931
IPR002182
168-455 NB-ARC,NBS
NB-ARC

VNVKKLVGYLVDEENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNESVAVRGDIKYLNFKPECLAIEDSWTLFQRIAFPKKDASESKVDEEMEDMGKQMLKHCGGLPLAIKVLGGLLAAKYTMHDWERLSVNIGSDIVGRTSSNNSSIYHVLSMSFEELPSYLKHCFLYLAHFPEDHKINVEKLSYCWAAEGISTAED

Gene3D: G3DSA:3.40.50.300
180-304 G3DSA:3.40.50.300

EENVQVVSITGMGGLGKTTLARQVFNHEDVKHQFDRLAWVCVSQEFTRKNVWQMILQNLTSREKKDEILQMEEAELHDKLFQLLETSKSLIVFDDIWKDEDWDLIKPIFPPNKGWKVLLTSQNES

FPrintScan: PR00364
IPR000767
185-200 DISEASERSIST
Disease resistance protein

VVSITGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
262-276 DISEASERSIST
Disease resistance protein

LLETSKSLIVFDDIW

FPrintScan: PR00364
IPR000767
360-374 DISEASERSIST
Disease resistance protein

CGGLPLAIKVLGGLL

superfamily: SSF52058
494-875 SSF52058,LRR

HLHDMMREVCLFKAKEENFLQIAVKSVGVTSSSTGNSQSPCRSRRLVYQCPTTLHVERDINNPKLRSLVVLWHDLWVENWKLLGTSFTRLKLLRVLDLFYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFIFVPDVFMRMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWHSSSKDLCGMTRLMTLAIRLTRVTSTETLSASISGLRNLEYLYIVGTHSKKMREEGIVLDFIHLKHLLLDLYMPRQQHFPSRLTFVKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSLELVML

Gene3D: G3DSA:3.80.10.10
567-731 G3DSA:3.80.10.10

DLWVENWKLLGTSFTRLKLLRVLDLFYVDFEGMKLPFGIGNLIHLRYLSLQDAKVSHLPSSLGNLMLLIYLNLDVDTEFIFVPDVFMRMHELRYLKLPLHMHKKTRLSLRNLVKLETLVYFSTWHSSSKDLCGMTRLMTLAIRLTRVTSTETLSASISGLRNLEY

Gene3D: G3DSA:3.80.10.10
776-872 G3DSA:3.80.10.10

VKLSECGLEEDPMPILEKLLHLKGVILLKGSYCGRRMVCSGGGFPQLKKLEIVGLNKWEEWLVEEGSMPLLETLSILDCEELKEIPDGLRFIYSLEL

FPrintScan: PR00364
IPR000767
841-857 DISEASERSIST
Disease resistance protein

GSMPLLETLSILDCEEL


List of References

A Kato, M Suzuki, A Kuwahara, H Ooe, K Higano-Inaba, Y Komeda
Isolation and analysis of cDNA within a 300 kb Arabidopsis thaliana genomic region located around the 100 map unit of chromosome 1.
Gene: 1999, 239(2);309-16
PubMed:10548732 WorldCat.org (P p)

A Theologis, J R Ecker, C J Palm, N A Federspiel, S Kaul, O White, J Alonso, H Altafi, R Araujo, C L Bowman, S Y Brooks, E Buehler, A Chan, Q Chao, H Chen, R F Cheuk, C W Chin, M K Chung, L Conn, A B Conway, A R Conway, T H Creasy, K Dewar, P Dunn, P Etgu, T V Feldblyum, J Feng, B Fong, C Y Fujii, J E Gill, A D Goldsmith, B Haas, N F Hansen, B Hughes, L Huizar, J L Hunter, J Jenkins, C Johnson-Hopson, S Khan, E Khaykin, C J Kim, H L Koo, I Kremenetskaia, D B Kurtz, A Kwan, B Lam, S Langin-Hooper, A Lee, J M Lee, C A Lenz, J H Li, Y Li, X Lin, S X Liu, Z A Liu, J S Luros, R Maiti, A Marziali, J Militscher, M Miranda, M Nguyen, W C Nierman, B I Osborne, G Pai, J Peterson, P K Pham, M Rizzo, T Rooney, D Rowley, H Sakano, S L Salzberg, J R Schwartz, P Shinn, A M Southwick, H Sun, L J Tallon, G Tambunga, M J Toriumi, C D Town, T Utterback, S Van Aken, M Vaysberg, V S Vysotskaia, M Walker, D Wu, G Yu, C M Fraser, J C Venter, R W Davis
Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
Nature: 2000, 408(6814);816-20
PubMed:11130712 WorldCat.org DOI (P p)

Kayoko Yamada, Jun Lim, Joseph M Dale, Huaming Chen, Paul Shinn, Curtis J Palm, Audrey M Southwick, Hank C Wu, Christopher Kim, Michelle Nguyen, Paul Pham, Rosa Cheuk, George Karlin-Newmann, Shirley X Liu, Bao Lam, Hitomi Sakano, Troy Wu, Guixia Yu, Molly Miranda, Hong L Quach, Matthew Tripp, Charlie H Chang, Jeong M Lee, Mitsue Toriumi, Marie M H Chan, Carolyn C Tang, Courtney S Onodera, Justine M Deng, Kenji Akiyama, Yasser Ansari, Takahiro Arakawa, Jenny Banh, Fumika Banno, Leah Bowser, Shelise Brooks, Piero Carninci, Qimin Chao, Nathan Choy, Akiko Enju, Andrew D Goldsmith, Mani Gurjal, Nancy F Hansen, Yoshihide Hayashizaki, Chanda Johnson-Hopson, Vickie W Hsuan, Kei Iida, Meagan Karnes, Shehnaz Khan, Eric Koesema, Junko Ishida, Paul X Jiang, Ted Jones, Jun Kawai, Asako Kamiya, Cristina Meyers, Maiko Nakajima, Mari Narusaka, Motoaki Seki, Tetsuya Sakurai, Masakazu Satou, Racquel Tamse, Maria Vaysberg, Erika K Wallender, Cecilia Wong, Yuki Yamamura, Shiaulou Yuan, Kazuo Shinozaki, Ronald W Davis, Athanasios Theologis, Joseph R Ecker
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science: 2003, 302(5646);842-6
PubMed:14593172 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox