PRGDB00186571 ()

From PRG Wiki
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank
Gene Class RPW8-NL
Domain Type NBS, LRR, RPW8, Others
Gene Species Arabidopsis thaliana

Comment?

DNA Sequence


Protein sequences

Name Description Sequence
Probable disease resistance protein At4g33300 RecName: Full=Probable disease resistance protein At4g33300.

MAITDFFAGEIATELLKQLFTISTTAWRYKNTAKQLLTLIDSIRPTIKEIQYSGVELPAHRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSVRLDRVDMSLDRVIQQVGSMKIGGGGLISEAMKRAEAMEIETNDDSEKFGVGLELGKVKVKKMMFESQGGVFGISGMGGVGKTTLAKELQRDHEVQCHFENRILFLTVSQSPLLEELRELIWGFLSGCEAGNPVPDCNFPFDGARKLVILDDVWTTQALDRLTSFKFPGCTTLVVSRSKLTEPKFTYDVEVLSEDEAISLFCLCAFGQKSIPLGFCKDLVKQVANECKGLPLALKVTGASLNGKPEMYWKGVLQRLSKGEPADDSHESRLLRQMEASLDNLDQTTKDCFLDLGAFPEDRKIPLDVLINIWIELHDIDEGNAFAILVDLSHKNLLTLGKDPRLGSLYASHYDIFVTQHDVLRDLALHLSNAGKVNRRKRLLMPKRELDLPGDWERNNDEHYIAQIVSIHTGEMNEMQWFDMEFPKAEILILNFSSDKYVLPPFISKMSRLKVLVIINNGMSPAVLHDFSIFAHLSKLRSLWLERVHVPQLSNSTTPLKNLHKMSLILCKINKSFDQTGLDVADIFPKLGDLTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGKLKKLEKIDMRECCFSDRPSSAVSLKSLRHVICDTDVAFMWEEVEKAVPGLKIEAAEKCFSLDWLDE

Domains

Domain Start-End Description Sequence

ProfileScan: PS51153
IPR008808
1-149 RPW8
Powdery mildew resistance protein, RPW8 domain

MAITDFFAGEIATELLKQLFTISTTAWRYKNTAKQLLTLIDSIRPTIKEIQYSGVELPAHRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSVRLDRVDMSLDRVIQQVG

HMMPfam: PF05659
IPR008808
15-132 RPW8
Powdery mildew resistance protein, RPW8 domain

LLKQLFTISTTAWRYKNTAKQLLTLIDSIRPTIKEIQYSGVELPAHRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSV

HMMPanther: PTHR23155:SF282
25-794 PTHR23155:SF282,SUBFAMILY NOT NAMED

TAWRYKNTAKQLLTLIDSIRPTIKEIQYSGVELPAHRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSVRLDRVDMSLDRVIQQVGSMKIGGGGLISEAMKRAEAMEIETNDDSEKFGVGLELGKVKVKKMMFESQGGVFGISGMGGVGKTTLAKELQRDHEVQCHFENRILFLTVSQSPLLEELRELIWGFLSGCEAGNPVPDCNFPFDGARKLVILDDVWTTQALDRLTSFKFPGCTTLVVSRSKLTEPKFTYDVEVLSEDEAISLFCLCAFGQKSIPLGFCKDLVKQVANECKGLPLALKVTGASLNGKPEMYWKGVLQRLSKGEPADDSHESRLLRQMEASLDNLDQTTKDCFLDLGAFPEDRKIPLDVLINIWIELHDIDEGNAFAILVDLSHKNLLTLGKDPRLGSLYASHYDIFVTQHDVLRDLALHLSNAGKVNRRKRLLMPKRELDLPGDWERNNDEHYIAQIVSIHTGEMNEMQWFDMEFPKAEILILNFSSDKYVLPPFISKMSRLKVLVIINNGMSPAVLHDFSIFAHLSKLRSLWLERVHVPQLSNSTTPLKNLHKMSLILCKINKSFDQTGLDVADIFPKLGDLTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGKLKKLEKIDMRECCFSDRPSSAVSLKSLRHVICDTDVAFMWEEVE

HMMPanther: PTHR23155
25-794 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TAWRYKNTAKQLLTLIDSIRPTIKEIQYSGVELPAHRQAQIGMLFDTLEKGKKLTDKVLSSKRWNLYRQLTLARKMEKLEKTISNFLKNEVFTHILADVHHLRADTSVRLDRVDMSLDRVIQQVGSMKIGGGGLISEAMKRAEAMEIETNDDSEKFGVGLELGKVKVKKMMFESQGGVFGISGMGGVGKTTLAKELQRDHEVQCHFENRILFLTVSQSPLLEELRELIWGFLSGCEAGNPVPDCNFPFDGARKLVILDDVWTTQALDRLTSFKFPGCTTLVVSRSKLTEPKFTYDVEVLSEDEAISLFCLCAFGQKSIPLGFCKDLVKQVANECKGLPLALKVTGASLNGKPEMYWKGVLQRLSKGEPADDSHESRLLRQMEASLDNLDQTTKDCFLDLGAFPEDRKIPLDVLINIWIELHDIDEGNAFAILVDLSHKNLLTLGKDPRLGSLYASHYDIFVTQHDVLRDLALHLSNAGKVNRRKRLLMPKRELDLPGDWERNNDEHYIAQIVSIHTGEMNEMQWFDMEFPKAEILILNFSSDKYVLPPFISKMSRLKVLVIINNGMSPAVLHDFSIFAHLSKLRSLWLERVHVPQLSNSTTPLKNLHKMSLILCKINKSFDQTGLDVADIFPKLGDLTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGKLKKLEKIDMRECCFSDRPSSAVSLKSLRHVICDTDVAFMWEEVE

HMMPfam: PF00931
IPR002182
191-443 NB-ARC,NBS
NB-ARC

VKKMMFESQGGVFGISGMGGVGKTTLAKELQRDHEVQCHFENRILFLTVSQSPLLEELRELIWGFLSGCEAGNPVPDCNFPFDGARKLVILDDVWTTQALDRLTSFKFPGCTTLVVSRSKLTEPKFTYDVEVLSEDEAISLFCLCAFGQKSIPLGFCKDLVKQVANECKGLPLALKVTGASLNGKPEMYWKGVLQRLSKGEPADDSHESRLLRQMEASLDNLDQTTKDCFLDLGAFPEDRKIPLDVLINIWIE

superfamily: SSF52540
198-387 SSF52540

SQGGVFGISGMGGVGKTTLAKELQRDHEVQCHFENRILFLTVSQSPLLEELRELIWGFLSGCEAGNPVPDCNFPFDGARKLVILDDVWTTQALDRLTSFKFPGCTTLVVSRSKLTEPKFTYDVEVLSEDEAISLFCLCAFGQKSIPLGFCKDLVKQVANECKGLPLALKVTGASLNGKPEMYWKGVLQRL

Gene3D: G3DSA:3.40.50.300
198-230 G3DSA:3.40.50.300

SQGGVFGISGMGGVGKTTLAKELQRDHEVQCHF

FPrintScan: PR00364
IPR000767
202-217 DISEASERSIST
Disease resistance protein

VFGISGMGGVGKTTLA

FPrintScan: PR00364
IPR000767
271-285 DISEASERSIST
Disease resistance protein

PFDGARKLVILDDVW

FPrintScan: PR00364
IPR000767
358-372 DISEASERSIST
Disease resistance protein

CKGLPLALKVTGASL

superfamily: SSF52047
554-780 SSF52047,LRR

PKAEILILNFSSDKYVLPPFISKMSRLKVLVIINNGMSPAVLHDFSIFAHLSKLRSLWLERVHVPQLSNSTTPLKNLHKMSLILCKINKSFDQTGLDVADIFPKLGDLTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGKLKKLEKIDMRECCFSDRPSSAVSLKSLRHV

Gene3D: G3DSA:3.80.10.10
561-780 G3DSA:3.80.10.10

LNFSSDKYVLPPFISKMSRLKVLVIINNGMSPAVLHDFSIFAHLSKLRSLWLERVHVPQLSNSTTPLKNLHKMSLILCKINKSFDQTGLDVADIFPKLGDLTIDHCDDLVALPSSICGLTSLSCLSITNCPRLGELPKNLSKLQALEILRLYACPELKTLPGEICELPGLKYLDISQCVSLSCLPEEIGKLKKLEKIDMRECCFSDRPSSAVSLKSLRHV

FPrintScan: PR00364
IPR000767
725-741 DISEASERSIST
Disease resistance protein

CELPGLKYLDISQCVSL

HMMPfam: PF00560
IPR001611
730-751 LRR_1
Leucine-rich repeat

LKYLDISQCVSLSCLPEEIGKL


List of References

K Mayer, C Schüller, R Wambutt, G Murphy, G Volckaert, T Pohl, A Düsterhöft, W Stiekema, K D Entian, N Terryn, B Harris, W Ansorge, P Brandt, L Grivell, M Rieger, M Weichselgartner, V de Simone, B Obermaier, R Mache, M Müller, M Kreis, M Delseny, P Puigdomenech, M Watson, T Schmidtheini, B Reichert, D Portatelle, M Perez-Alonso, M Boutry, I Bancroft, P Vos, J Hoheisel, W Zimmermann, H Wedler, P Ridley, S A Langham, B McCullagh, L Bilham, J Robben, J Van der Schueren, B Grymonprez, Y J Chuang, F Vandenbussche, M Braeken, I Weltjens, M Voet, I Bastiaens, R Aert, E Defoor, T Weitzenegger, G Bothe, U Ramsperger, H Hilbert, M Braun, E Holzer, A Brandt, S Peters, M van Staveren, W Dirske, P Mooijman, R Klein Lankhorst, M Rose, J Hauf, P Kötter, S Berneiser, S Hempel, M Feldpausch, S Lamberth, H Van den Daele, A De Keyser, C Buysshaert, J Gielen, R Villarroel, R De Clercq, M Van Montagu, J Rogers, A Cronin, M Quail, S Bray-Allen, L Clark, J Doggett, S Hall, M Kay, N Lennard, K McLay, R Mayes, A Pettett, M A Rajandream, M Lyne, V Benes, S Rechmann, D Borkova, H Blöcker, M Scharfe, M Grimm, T H Löhnert, S Dose, M de Haan, A Maarse, M Schäfer, S Müller-Auer, C Gabel, M Fuchs, B Fartmann, K Granderath, D Dauner, A Herzl, S Neumann, A Argiriou, D Vitale, R Liguori, E Piravandi, O Massenet, F Quigley, G Clabauld, A Mündlein, R Felber, S Schnabl, R Hiller, W Schmidt, A Lecharny, S Aubourg, F Chefdor, R Cooke, C Berger, A Montfort, E Casacuberta, T Gibbons, N Weber, M Vandenbol, M Bargues, J Terol, A Torres, A Perez-Perez, B Purnelle, E Bent, S Johnson, D Tacon, T Jesse, L Heijnen, S Schwarz, P Scholler, S Heber, P Francs, C Bielke, D Frishman, D Haase, K Lemcke, H W Mewes, S Stocker, P Zaccaria, M Bevan, R K Wilson, M de la Bastide, K Habermann, L Parnell, N Dedhia, L Gnoj, K Schutz, E Huang, L Spiegel, M Sehkon, J Murray, P Sheet, M Cordes, J Abu-Threideh, T Stoneking, J Kalicki, T Graves, G Harmon, J Edwards, P Latreille, L Courtney, J Cloud, A Abbott, K Scott, D Johnson, P Minx, D Bentley, B Fulton, N Miller, T Greco, K Kemp, J Kramer, L Fulton, E Mardis, M Dante, K Pepin, L Hillier, J Nelson, J Spieth, E Ryan, S Andrews, C Geisel, D Layman, H Du, J Ali, A Berghoff, K Jones, K Drone, M Cotton, C Joshu, B Antonoiu, M Zidanic, C Strong, H Sun, B Lamar, C Yordan, P Ma, J Zhong, R Preston, D Vil, M Shekher, A Matero, R Shah, I K Swaby, A O'Shaughnessy, M Rodriguez, J Hoffmann, S Till, S Granat, N Shohdy, A Hasegawa, A Hameed, M Lodhi, A Johnson, E Chen, M Marra, R Martienssen, W R McCombie
Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.
Nature: 1999, 402(6763);769-77
PubMed:10617198 WorldCat.org DOI (P p)

Kei Iida, Kaoru Fukami-Kobayashi, Atsushi Toyoda, Yoshiyuki Sakaki, Masatomo Kobayashi, Motoaki Seki, Kazuo Shinozaki
Analysis of multiple occurrences of alternative splicing events in Arabidopsis thaliana using novel sequenced full-length cDNAs.
DNA Res.: 2009, 16(3);155-64
PubMed:19423640 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox