PRGDB00186590 ()

From PRG Wiki
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

DNA Sequence


Protein sequences

Name Description Sequence
Probable disease resistance protein At5g43740 RecName: Full=Probable disease resistance protein At5g43740.

MLGWLVIPWNQIFTAACGCFLSDRNYIHMMESNLDALQKTMEELKNGRDDLLGRVSIEEDKGLQRLAQVNGWLSRVQIVESEFKDLLEAMSIETGRLCLLGYCSEDCISSYNYGEKVSKMLEEVKELLSKKDFRMVAQEIIHKVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSHAINVLNSAGHEFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDSEIPKEKWIEYWICEGFINPNRYEDGGTNHGYDIIGLLVRAHLLIECELTDNVKMHDVIREMALWINSDFGKQQETICVKSGAHVRMIPNDINWEIVRTMSFTCTQIKKISCRSKCPNLSTLLILDNRLLVKISNRFFRFMPKLVVLDLSANLDLIKLPEEISNLGSLQYLNISLTGIKSLPVGLKKLRKLIYLNLEFTGVHGSLVGIAATLPNLQVLKFFYSCVYVDDILMKELQDLEHLKILTANVKDVTILERIQGDDRLASSIRSLCLEDMSTPRVILSTIALGGLQQLAILMCNISEIRIDWESKERRELSPTEILPSTGSPGFKQLSTVYINQLEGQRDLSWLLYAQNLKKLEVCWSPQIEEIINKEKGMNITKLHRDIVVPFGNLEDLALRQMADLTEICWNYRTLPNLRKSYINDCPKLPEDIFVPLLPEKSPSRFFFF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF115
5-846 PTHR23155:SF115,DISEASE RESISTANCE PROTEIN (CC-NBS-LRR CLASS)

LVIPWNQIFTAACGCFLSDRNYIHMMESNLDALQKTMEELKNGRDDLLGRVSIEEDKGLQRLAQVNGWLSRVQIVESEFKDLLEAMSIETGRLCLLGYCSEDCISSYNYGEKVSKMLEEVKELLSKKDFRMVAQEIIHKVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSHAINVLNSAGHEFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDSEIPKEKWIEYWICEGFINPNRYEDGGTNHGYDIIGLLVRAHLLIECELTDNVKMHDVIREMALWINSDFGKQQETICVKSGAHVRMIPNDINWEIVRTMSFTCTQIKKISCRSKCPNLSTLLILDNRLLVKISNRFFRFMPKLVVLDLSANLDLIKLPEEISNLGSLQYLNISLTGIKSLPVGLKKLRKLIYLNLEFTGVHGSLVGIAATLPNLQVLKFFYSCVYVDDILMKELQDLEHLKILTANVKDVTILERIQGDDRLASSIRSLCLEDMSTPRVILSTIALGGLQQLAILMCNISEIRIDWESKERRELSPTEILPSTGSPGFKQLSTVYINQLEGQRDLSWLLYAQNLKKLEVCWSPQIEEIINKEKGMNITKLHRDIVVPFGNLEDLALRQMADLTEICWNYRTLPNLRKSYINDCPKLPEDI

HMMPanther: PTHR23155
5-846 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LVIPWNQIFTAACGCFLSDRNYIHMMESNLDALQKTMEELKNGRDDLLGRVSIEEDKGLQRLAQVNGWLSRVQIVESEFKDLLEAMSIETGRLCLLGYCSEDCISSYNYGEKVSKMLEEVKELLSKKDFRMVAQEIIHKVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSHAINVLNSAGHEFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDSEIPKEKWIEYWICEGFINPNRYEDGGTNHGYDIIGLLVRAHLLIECELTDNVKMHDVIREMALWINSDFGKQQETICVKSGAHVRMIPNDINWEIVRTMSFTCTQIKKISCRSKCPNLSTLLILDNRLLVKISNRFFRFMPKLVVLDLSANLDLIKLPEEISNLGSLQYLNISLTGIKSLPVGLKKLRKLIYLNLEFTGVHGSLVGIAATLPNLQVLKFFYSCVYVDDILMKELQDLEHLKILTANVKDVTILERIQGDDRLASSIRSLCLEDMSTPRVILSTIALGGLQQLAILMCNISEIRIDWESKERRELSPTEILPSTGSPGFKQLSTVYINQLEGQRDLSWLLYAQNLKKLEVCWSPQIEEIINKEKGMNITKLHRDIVVPFGNLEDLALRQMADLTEICWNYRTLPNLRKSYINDCPKLPEDI

superfamily: SSF52540
134-367 SSF52540

RMVAQEIIHKVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSH

Gene3D: G3DSA:3.40.50.300
138-261 G3DSA:3.40.50.300

QEIIHKVEKKLIQTTVGLDKLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDL

HMMPfam: PF00931
IPR002182
157-436 NB-ARC,NBS
NB-ARC

KLVEMAWSSLMNDEIGTLGLYGMGGVGKTTLLESLNNKFVELESEFDVVIWVVVSKDFQFEGIQDQILGRLRSDKEWERETESKKASLIYNNLERKKFVLLLDDLWSEVDMTKIGVPPPTRENGSKIVFTTRSTEVCKHMKADKQIKVACLSPDEAWELFRLTVGDIILRSHQDIPALARIVAAKCHGLPLALNVIGKAMSCKETIQEWSHAINVLNSAGHEFPGMEERILPILKFSYDSLKNGEIKLCFLYCSLFPEDSEIPKEKWIEYWICEGFINPN

FPrintScan: PR00364
IPR000767
173-188 DISEASERSIST
Disease resistance protein

TLGLYGMGGVGKTTLL

FPrintScan: PR00364
IPR000767
248-262 DISEASERSIST
Disease resistance protein

NLERKKFVLLLDDLW

FPrintScan: PR00364
IPR000767
342-356 DISEASERSIST
Disease resistance protein

CHGLPLALNVIGKAM

superfamily: SSF52058
484-842 SSF52058,LRR

DFGKQQETICVKSGAHVRMIPNDINWEIVRTMSFTCTQIKKISCRSKCPNLSTLLILDNRLLVKISNRFFRFMPKLVVLDLSANLDLIKLPEEISNLGSLQYLNISLTGIKSLPVGLKKLRKLIYLNLEFTGVHGSLVGIAATLPNLQVLKFFYSCVYVDDILMKELQDLEHLKILTANVKDVTILERIQGDDRLASSIRSLCLEDMSTPRVILSTIALGGLQQLAILMCNISEIRIDWESKERRELSPTEILPSTGSPGFKQLSTVYINQLEGQRDLSWLLYAQNLKKLEVCWSPQIEEIINKEKGMNITKLHRDIVVPFGNLEDLALRQMADLTEICWNYRTLPNLRKSYINDCPKL

Gene3D: G3DSA:3.80.10.10
510-653 G3DSA:3.80.10.10

EIVRTMSFTCTQIKKISCRSKCPNLSTLLILDNRLLVKISNRFFRFMPKLVVLDLSANLDLIKLPEEISNLGSLQYLNISLTGIKSLPVGLKKLRKLIYLNLEFTGVHGSLVGIAATLPNLQVLKFFYSCVYVDDILMKELQDL

FPrintScan: PR00364
IPR000767
554-570 DISEASERSIST
Disease resistance protein

RFMPKLVVLDLSANLDL

Gene3D: G3DSA:3.80.10.10
768-840 G3DSA:3.80.10.10

QNLKKLEVCWSPQIEEIINKEKGMNITKLHRDIVVPFGNLEDLALRQMADLTEICWNYRTLPNLRKSYINDCP


List of References

Kayoko Yamada, Jun Lim, Joseph M Dale, Huaming Chen, Paul Shinn, Curtis J Palm, Audrey M Southwick, Hank C Wu, Christopher Kim, Michelle Nguyen, Paul Pham, Rosa Cheuk, George Karlin-Newmann, Shirley X Liu, Bao Lam, Hitomi Sakano, Troy Wu, Guixia Yu, Molly Miranda, Hong L Quach, Matthew Tripp, Charlie H Chang, Jeong M Lee, Mitsue Toriumi, Marie M H Chan, Carolyn C Tang, Courtney S Onodera, Justine M Deng, Kenji Akiyama, Yasser Ansari, Takahiro Arakawa, Jenny Banh, Fumika Banno, Leah Bowser, Shelise Brooks, Piero Carninci, Qimin Chao, Nathan Choy, Akiko Enju, Andrew D Goldsmith, Mani Gurjal, Nancy F Hansen, Yoshihide Hayashizaki, Chanda Johnson-Hopson, Vickie W Hsuan, Kei Iida, Meagan Karnes, Shehnaz Khan, Eric Koesema, Junko Ishida, Paul X Jiang, Ted Jones, Jun Kawai, Asako Kamiya, Cristina Meyers, Maiko Nakajima, Mari Narusaka, Motoaki Seki, Tetsuya Sakurai, Masakazu Satou, Racquel Tamse, Maria Vaysberg, Erika K Wallender, Cecilia Wong, Yuki Yamamura, Shiaulou Yuan, Kazuo Shinozaki, Ronald W Davis, Athanasios Theologis, Joseph R Ecker
Empirical analysis of transcriptional activity in the Arabidopsis genome.
Science: 2003, 302(5646);842-6
PubMed:14593172 WorldCat.org DOI (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox