PRGDB00186608 ()

From PRG Wiki
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum bulbocastanum

Comment?

DNA Sequence


Protein sequences

Name Description Sequence
Putative disease resistance protein RGA1 RecName: Full=Putative disease resistance protein RGA1; AltName: Full=RGA3-blb.

MAEAFIQVVLDNLTSFLKGELVLLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNDKPLENWLQKLNAATYEVDDILDEYKTKATRFLQSEYGRYHPKVIPFRHKVGKRMDQVMKKLNAIAEERKKFHLQEKIIERQAATRETGSVLTEPQVYGRDKEKDEIVKILINTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLMAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEVESGKTYFKMHDLIHDLATSLFSANTSSSNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPRIGLLTCLKSLSCFVIGKRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEINGFGGIRLPDWMNQSVLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSADVEYVEDNVHPGRFPSLRKLVIWDFSNLKGLLKMEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIVTDATVLRSISNLRALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCPIVFKRCERGIGEDWHKIAHIPYLTLYE

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
13-952 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LTSFLKGELVLLFGFQDEFQRLSSMFSTIQAVLEDAQEKQLNDKPLENWLQKLNAATYEVDDILDEYKTKATRFLQSEYGRYHPKVIPFRHKVGKRMDQVMKKLNAIAEERKKFHLQEKIIERQAATRETGSVLTEPQVYGRDKEKDEIVKILINTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLMAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFLLSKGNLELEDVGNEVWNELYLRSFFQEIEVESGKTYFKMHDLIHDLATSLFSANTSSSNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPRIGLLTCLKSLSCFVIGKRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEINGFGGIRLPDWMNQSVLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSADVEYVEDNVHPGRFPSLRKLVIWDFSNLKGLLKMEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIVTDATVLRSISNLRALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCP

superfamily: SSF52540
134-383 SSF52540

ERQAATRETGSVLTEPQVYGRDKEKDEIVKILINTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLMAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQD

Gene3D: G3DSA:3.40.50.300
153-294 G3DSA:3.40.50.300

GRDKEKDEIVKILINTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLE

HMMPfam: PF00931
IPR002182
155-433 NB-ARC,NBS
NB-ARC

DKEKDEIVKILINTASDAQKLSVLPILGMGGLGKTTLSQMVFNDQRVTERFYPKIWICISDDFNEKRLIKAIVESIEGKSLSDMDLAPLQKKLQELLNGKRYFLVLDDVWNEDQHKWANLRAVLKVGASGAFVLTTTRLEKVGSIMGTLQPYELSNLSPEDCWFLFMQRAFGHQEEINPNLMAIGKEIVKKCGGVPLAAKTLGGILRFKREEREWEHVRDSPIWNLPQDESSILPALRLSYHHLPLDLRQCFVYCAVFPKDTKMAKENLIAFWMAHGFL

FPrintScan: PR00364
IPR000767
177-192 DISEASERSIST
Disease resistance protein

VLPILGMGGLGKTTLS

FPrintScan: PR00364
IPR000767
250-264 DISEASERSIST
Disease resistance protein

LLNGKRYFLVLDDVW

FPrintScan: PR00364
IPR000767
346-360 DISEASERSIST
Disease resistance protein

CGGVPLAAKTLGGIL

superfamily: SSF52058
471-818 SSF52058,LRR

KMHDLIHDLATSLFSANTSSSNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPRIGLLTCLKSLSCFVIGKRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEINGFGGIRLPDWMNQSVLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSADVEYVEDNVHPGRFPSLRKLVIWDFSNLKGLLKMEGEKQFPVLEEMTFYWCPMFVIP

Gene3D: G3DSA:3.80.10.10
491-710 G3DSA:3.80.10.10

SNIREINANYDGYMMSIGFAEVVSSYSPSLLQKFVSLRVLNLRNSNLNQLPSSIGDLVHLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSLTSTPPRIGLLTCLKSLSCFVIGKRKGHQLGELKNLNLYGSISITKLDRVKKDTDAKEANLSAKANLHSLCLSWDLDGKHRYDSEVLEALKPHSNLKYLEING

HMMPfam: PF00560
IPR001611
526-546 LRR_1
Leucine-rich repeat

SLRVLNLRNSNLNQLPSSIGD

ProfileScan: PS51450
IPR001611
526-547 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRVLNLRNSNLNQLPSSIGDL

HMMPfam: PF13855
549-608 LRR_8,Leucine rich repeat

HLRYLDLSGNFRIRNLPKRLCKLQNLQTLDLHYCDSLSCLPKQTSKLGSLRNLLLDGCSL

ProfileScan: PS51450
IPR001611
549-572 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRYLDLSGNFRIRNLPKRLCKLQ

FPrintScan: PR00364
IPR000767
569-585 DISEASERSIST
Disease resistance protein

CKLQNLQTLDLHYCDSL

ProfileScan: PS51450
IPR001611
573-595 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQTLDLHYCDSLSCLPKQTSKL

ProfileScan: PS51450
IPR001611
597-618 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRNLLLDGCSLTSTPPRIGLL

Gene3D: G3DSA:3.80.10.10
724-954 G3DSA:3.80.10.10

VLKNVVSIRIRGCENCSCLPPFGELPCLESLELHTGSADVEYVEDNVHPGRFPSLRKLVIWDFSNLKGLLKMEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIVTDATVLRSISNLRALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCPIV

superfamily: SSF52058
740-954 SSF52058,LRR

SCLPPFGELPCLESLELHTGSADVEYVEDNVHPGRFPSLRKLVIWDFSNLKGLLKMEGEKQFPVLEEMTFYWCPMFVIPTLSSVKTLKVIVTDATVLRSISNLRALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLKELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTALTTLTITQCPIV

HMMPfam: PF13855
844-902 LRR_8,Leucine rich repeat

ALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLKELPTSLASLNALKSLKFEFC

ProfileScan: PS51450
IPR001611
844-866 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALTSLDISDNVEATSLPEEMFKS

HMMPfam: PF00560
IPR001611
918-940 LRR_1
Leucine-rich repeat

SLTELSVSNCMMLKCLPEGLQHL


List of References

Junqi Song, James M Bradeen, S Kristine Naess, John A Raasch, Susan M Wielgus, Geraldine T Haberlach, Jia Liu, Hanhui Kuang, Sandra Austin-Phillips, C Robin Buell, John P Helgeson, Jiming Jiang
Gene RB cloned from Solanum bulbocastanum confers broad spectrum resistance to potato late blight.
Proc. Natl. Acad. Sci. U.S.A.: 2003, 100(16);9128-33
PubMed:12872003 WorldCat.org DOI (P p)

Edwin van der Vossen, Anne Sikkema, Bas te Lintel Hekkert, Jack Gros, Patricia Stevens, Marielle Muskens, Doret Wouters, Andy Pereira, Willem Stiekema, Sjefke Allefs
An ancient R gene from the wild potato species Solanum bulbocastanum confers broad-spectrum resistance to Phytophthora infestans in cultivated potato and tomato.
Plant J.: 2003, 36(6);867-82
PubMed:14675451 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox