PRGDB00186628 ()

From PRG Wiki
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 335355778 (HM446514)
Gene Class NL
Domain Type NBS, LRR
Gene Species Mangifera indica

Comment?

Mangifera indica NBS-LRR disease resistance protein (MRNBS8) gene, exon and partial cds.

DNA Sequence

GGTATGGGCGGTATCGGTAAGACTACTTTTGCTACTGTTGTATTCAACAAAATCTTCAGACAGTTTGAAGTTTCTTACTTCGCTCAAAATATTAGAGAAGAATCAGAGAAAAATGGCGGACTAAATGACATGCGCCAAAAACTCCTTTGTGCACTCTCAGGGGATGTAAATCCCAATATTGGATTCATCTTCCCAAGAGAAAGACTTATTGCCAAGAAAGCTCTCATTGTGCTTGATGATGTTTGG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein, partial [Mangifera indica].

GMGGIGKTTFATVVFNKIFRQFEVSYFAQNIREESEKNGGLNDMRQKLLCALSGDVNPNIGFIFPRERLIAKKALIVLDDVW


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-82 PTHR11017:SF20,SUBFAMILY NOT NAMED

GMGGIGKTTFATVVFNKIFRQFEVSYFAQNIREESEKNGGLNDMRQKLLCALSGDVNPNIGFIFPRERLIAKKALIVLDDVW

HMMPfam: PF00931
IPR002182
1-82 NB-ARC,NBS
NB-ARC

GMGGIGKTTFATVVFNKIFRQFEVSYFAQNIREESEKNGGLNDMRQKLLCALSGDVNPNIGFIFPRERLIAKKALIVLDDVW

HMMPanther: PTHR11017
1-82 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GMGGIGKTTFATVVFNKIFRQFEVSYFAQNIREESEKNGGLNDMRQKLLCALSGDVNPNIGFIFPRERLIAKKALIVLDDVW






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox