PRGDB00186648 ()

From PRG Wiki
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 364285578 (HQ853197)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Solanum fernandezianum

Comment?

Solanum fernandezianum voucher CGN18243 disease resistance protein RGH5 gene, complete cds.

DNA Sequence

ATGGCTTATGCTGCTGTTACTTCCGTTATGAGAACCATACATCAATCAATGGAACTTACTGGATGTGATTTGCAACCGTTTTATGAAAAGCTCAAATCTTTGAGAGCTATTCTGGAAAAATCCTGCAATATAATGGGCGATCATGAGGGGTTAACAATCTTGGAAGTTGAAATCATAGAGGTAGCATACACAACAGAAGATATGGTTGACTCGGAATCAAGAAATATTTTTTTAGCACGGAATGTGGGGAAAAGAAGCAGGGCTATGTGGGGGATTTTTTTCGTCTTGGAACAAGCACTAGAATGCATTGATTCCACCGTGAAACAGTGGATGGCAACATCGGACAGCATGAAAGATCTAAAACCACAAACTAGCTCACTTGTCAGTTTCCCTGAACATGATGTTGAGCAGCCCGAGAATATAATGGTTGGCCGTGAAAATGAATTTGAGATGATGCTGGATCAACTTGTTAGAGGAGGAAGGGAACTAGAAGTTGTCTCAATCGTAGGGACGGGAGGTATCGGGAAAACAACTTTGGCTACAAAACTCTATAGTGATCCTTACATTATGTCTCGATTTGATATTCGTGCAAAAGCAACTGTTTCACAAGAGTATTGTGTGAGAAATGTACTCCTAGGCCTTCTTTCTTTGACAAGTGATGAACCTGATTATCATCTAGCGGACCGACTGCGAAAGCATCTGAAAGGCAGGAGATACTTGGTAGTCATTGATGACATATGGACTACAGAAGCTTGGGATGATATAAAACTATGTTTCCCAGACTGTTATAATGGAAGCAGAATACTCCTGACTACTCGGAATGTGGAAGTGGCTGAATATGCTAGTTCAGGTAAGCCTCCTCATCACATGCGCCTCATGAATTTTGACGAAAGTTGGAATTTACTACACAAAAAGATCTTTGAAAAAGAAGGTTCTTATTCTCCTGAATTTGAAAATATTGGGAAACAAATTGCATTAAAATGTGGAGGATTACCTCTAGCAATTACTGTGATTGCTGGACTTCTCTCCAAAATCGGTCAAAGACTAGATGAGTGGCAAAGAATTGCGGAGAATGTAAGTTCGGTGGTAAGCACAGATCCTGAAGCACAATGCATGAGAGTGTTGGCTTTGAGTTACCATCACTTGCCTTCTCACCTAAAACCGTGTTTTCTATATTTTGCAATTTTCGCAGAGGATGAACAGATTTATGTAAATAAACTTGTTGAGTTATGGGCCGTAGAGGGGTTTTTGAATGAAGAAGAGGGAAAAAGCATAGAAGAGGTGGCAACAACATGTATAAATGAACTTATAGATAGAAGCTTAATTTTCATCCACAATTTTAGTTTTCGTGGAACAATAGAAAGTTGTGGAATGCATGATGTGACCCGTGAACTCTGTTTGAGGGAAGCTCGAAACATGAATTTTGTGAATGTTATCAGAGGAAAGAGTGATCAAAATTCATGTGTACAATACATGCAGTGTTCCTTTAAGAAGCGAAGTCGGATCAGTATCTATAAGGAGGAAGAATTGGCTTGGTGTCGTAACAGTGAGGCTCATTCTATTATCATGTCGCGTGGATTCAATTGCATCACACTGGAATTGTCTTTCAAGCTAGTAAGAGTACTAGATCTTGGTTGGACTCCATGCCCAATTTTTCCCAGTGGAGTACTTTCTCTAATTCATTTGAGATACCTATCTTTGTGTTTTAATCCTTGCTTACTGCAGTATCAAGGATCGATAGAAGCTGTTCCCTCATCAATAATAGACATTCCTCTATCGATATCACGCCTATGCTATCTGCAAACTTTTAAACTTTACCTTCCATTTACCGATAGTTATCCTTTCATATTACCATCGGAAATTTTGATGATGCCACAATTGAGGAAGCTGCGTATGGGCTGGAATTACTTGCGGAGTCATGAGCCTACAGAGAACAGATTGGTTTTGAAAAGTTTGCAATGCCTCAATCAATTGAATCCTCGGAATTGTACAGGGTCTTTTTTTAGACTATTTCCCAATTTAAAGAAGTTGAAAGTATTTGGCGTCCAAGAGGACTTTCGCAATCACAAGGACCTGTATGATTTTCGCTACTTATATCAGCTCAAGAAATTGGCATTTCGTGTTTATTATCCAGGTGCTGCTTGTGTTCTAGAAAGCACTGCACCTTCAGGTTCTACTCCGCAAGATCCTCTGAGGTTTCAGACGAAATTATTGTACAAAAAGACACAATTCGGGAAAGCTGCACCTCCAGCTGATGTTCCAACTTTACTCTTACCTCCTCCGGATGCTTTTCCACAAAACCTTAAGAGTTTAACTTTTAGCGGAGAATTCTTTTTGGCATCGAAGGATTTGAGCATTGTTGGTAAATTACCCGAACTCGAGGTCCTTAAACTATCAGACAATGCTGTCATAGGCGAGGAGTGGGAAGTAGTTGAGGAAGGGTTTCCTCACTTGAAGTTCTTGTTTCTGGATAACATATACATTCGGTACTGGAGAGCTAGTAGTGATCACTTTCCGTACCTTGAACGACTTTTTCTTAGAAATTGCTATGATTTGGATTCAATCCCTCGAGATTTTGCAGATATAACCACACTAGCTCTTATTGATATAAGTAGCTGTCGACAATCTGTTGGGAAATCCGCCAAGCAAATTCAACAGGACATTCAAGACAACTATGGAAGCTCTATCGAGGTCCATACTCGACATCTTTTAAAGCATTTTCGATATAACAACAGATGA


Protein sequences

Name Description Sequence
disease resistance protein RGH5 disease resistance protein RGH5 [Solanum fernandezianum].

MAYAAVTSVMRTIHQSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHEGLTILEVEIIEVAYTTEDMVDSESRNIFLARNVGKRSRAMWGIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSFPEHDVEQPENIMVGRENEFEMMLDQLVRGGRELEVVSIVGTGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYHLADRLRKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIGQRLDEWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAEDEQIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDVTRELCLREARNMNFVNVIRGKSDQNSCVQYMQCSFKKRSRISIYKEEELAWCRNSEAHSIIMSRGFNCITLELSFKLVRVLDLGWTPCPIFPSGVLSLIHLRYLSLCFNPCLLQYQGSIEAVPSSIIDIPLSISRLCYLQTFKLYLPFTDSYPFILPSEILMMPQLRKLRMGWNYLRSHEPTENRLVLKSLQCLNQLNPRNCTGSFFRLFPNLKKLKVFGVQEDFRNHKDLYDFRYLYQLKKLAFRVYYPGAACVLESTAPSGSTPQDPLRFQTKLLYKKTQFGKAAPPADVPTLLLPPPDAFPQNLKSLTFSGEFFLASKDLSIVGKLPELEVLKLSDNAVIGEEWEVVEEGFPHLKFLFLDNIYIRYWRASSDHFPYLERLFLRNCYDLDSIPRDFADITTLALIDISSCRQSVGKSAKQIQQDIQDNYGSSIEVHTRHLLKHFRYNNR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF129
1-480 OS06G0286500 PROTEIN

MAYAAVTSVMRTIHQSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHEGLTILEVEIIEVAYTTEDMVDSESRNIFLARNVGKRSRAMWGIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSFPEHDVEQPENIMVGRENEFEMMLDQLVRGGRELEVVSIVGTGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYHLADRLRKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIGQRLDEWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAEDEQIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDVTRELCLREARNMNFVNVIR

HMMPanther: PTHR11017
1-480 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MAYAAVTSVMRTIHQSMELTGCDLQPFYEKLKSLRAILEKSCNIMGDHEGLTILEVEIIEVAYTTEDMVDSESRNIFLARNVGKRSRAMWGIFFVLEQALECIDSTVKQWMATSDSMKDLKPQTSSLVSFPEHDVEQPENIMVGRENEFEMMLDQLVRGGRELEVVSIVGTGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYHLADRLRKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIGQRLDEWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAEDEQIYVNKLVELWAVEGFLNEEEGKSIEEVATTCINELIDRSLIFIHNFSFRGTIESCGMHDVTRELCLREARNMNFVNVIR

superfamily: SSF52540
117-366 P-loop containing nucleoside triphosphate hydrolases

MKDLKPQTSSLVSFPEHDVEQPENIMVGRENEFEMMLDQLVRGGRELEVVSIVGTGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYHLADRLRKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIGQRLDEWQRIAENVSSVVSTD

HMMPfam: PF00931
IPR002182
145-420 NB-ARC,NBS
NB-ARC

RENEFEMMLDQLVRGGRELEVVSIVGTGGIGKTTLATKLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDEPDYHLADRLRKHLKGRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPHHMRLMNFDESWNLLHKKIFEKEGSYSPEFENIGKQIALKCGGLPLAITVIAGLLSKIGQRLDEWQRIAENVSSVVSTDPEAQCMRVLALSYHHLPSHLKPCFLYFAIFAEDEQIYVNKLVELWAVEGFLNEE

FPrintScan: PR00364
IPR000767
165-180 DISEASERSIST
Disease resistance protein

VVSIVGTGGIGKTTLA

FPrintScan: PR00364
IPR000767
233-247 DISEASERSIST
Disease resistance protein

HLKGRRYLVVIDDIW

FPrintScan: PR00364
IPR000767
328-342 DISEASERSIST
Disease resistance protein

CGGLPLAITVIAGLL

superfamily: SSF52058
457-874 L domain-like,LRR

GMHDVTRELCLREARNMNFVNVIRGKSDQNSCVQYMQCSFKKRSRISIYKEEELAWCRNSEAHSIIMSRGFNCITLELSFKLVRVLDLGWTPCPIFPSGVLSLIHLRYLSLCFNPCLLQYQGSIEAVPSSIIDIPLSISRLCYLQTFKLYLPFTDSYPFILPSEILMMPQLRKLRMGWNYLRSHEPTENRLVLKSLQCLNQLNPRNCTGSFFRLFPNLKKLKVFGVQEDFRNHKDLYDFRYLYQLKKLAFRVYYPGAACVLESTAPSGSTPQDPLRFQTKLLYKKTQFGKAAPPADVPTLLLPPPDAFPQNLKSLTFSGEFFLASKDLSIVGKLPELEVLKLSDNAVIGEEWEVVEEGFPHLKFLFLDNIYIRYWRASSDHFPYLERLFLRNCYDLDSIPRDFADITTLALIDISSCR

Seg: seg
584-595 seg

PSSIIDIPLSIS

Gene3D: G3DSA:3.80.10.10
767-876 no description

NLKSLTFSGEFFLASKDLSIVGKLPELEVLKLSDNAVIGEEWEVVEEGFPHLKFLFLDNIYIRYWRASSDHFPYLERLFLRNCYDLDSIPRDFADITTLALIDISSCRQS

FPrintScan: PR00364
IPR000767
788-804 DISEASERSIST
Disease resistance protein

GKLPELEVLKLSDNAVI

Seg: seg
805-814 seg

GEEWEVVEEG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox