PRGDB00186688 ()

From PRG Wiki
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 363548163 (JN426986)
Gene Class NL
Domain Type NBS, LRR
Gene Species Curcuma zedoaria

Comment?

Curcuma zedoaria clone Czp22 NBS-LRR disease resistance protein gene, partial cds.

DNA Sequence

GGCGGCGTGGGCAAAACCACCCTGGCGAAAATTGTGTATGATAAAACCGCGATTATTGGCGGCCATTTTCAGTATCGCGCGTGGATTGCGGTGAGCCAGAACTATAACATTAAAGAACTGCTGAAAAAAATTATTCGCCAGATTAGCGTGAAAGAAGAACAGATTAGCCTGGGCTGCCAGGATAGCAGCCTGAACACCGAACAGCTGCTGAACATGATGGATGATAGCCAGCTGGTGCAGATTGTGCGCCGCCATCTGAACAAAAAACGCTATCTGCTGGTGTTTGATGATGTGTGGCGCACCGGCGCGTGGGAAAGCCTGAACATTGCGCTGCCGCCGGGCAAAGAAGGCAGCCGCGTGATTGTGACCACCCGCATTGAAGAAGTGGCGATTCCGAGCTGCTATCGCCATCAGTTTATTTTTAAAGTGAGCCCGAGCAGCTATCAGCTGAGCTGGGAACTGCTGTGCCGCCGCGTGTTTAAAGTGCCGGATTATAGCTGCCCGCCGGAACTGGAAGAATATCTGCGCCGCACCATTATTGTGCTGGGCCTGCCGCTGGCGTGG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein, partial [Curcuma zedoaria].

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQISLGCQDSSLNTEQLLNMMDDSQLVQIVRRHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAIPSCYRHQFIFKVSPSSYQLSWELLCRRVFKVPDYSCPPELEEYLRRTIIVLGLPLAW


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-176 SSF52540

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQISLGCQDSSLNTEQLLNMMDDSQLVQIVRRHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAIPSCYRHQFIFKVSPSSYQLSWELLCRRVFKVPDYSCPPELEEYLR

HMMPfam: PF00931
IPR002182
1-187 NB-ARC,NBS
NB-ARC

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQISLGCQDSSLNTEQLLNMMDDSQLVQIVRRHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAIPSCYRHQFIFKVSPSSYQLSWELLCRRVFKVPDYSCPPELEEYLRRTIIVLGLPLA

HMMPanther: PTHR23155
1-118 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQISLGCQDSSLNTEQLLNMMDDSQLVQIVRRHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGS

HMMPanther: PTHR23155:SF121
1-118 PTHR23155:SF121,SUBFAMILY NOT NAMED

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQISLGCQDSSLNTEQLLNMMDDSQLVQIVRRHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox