PRGDB00186689 ()

From PRG Wiki
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 363548161 (JN426985)
Gene Class NL
Domain Type NBS, LRR
Gene Species Curcuma zedoaria

Comment?

Curcuma zedoaria clone Czp21 NBS-LRR disease resistance protein gene, partial cds.

DNA Sequence

GGCGGCGTGGGCAAAACCACCCTGGCGAAAATTGTGTATGATAAAACCGCGATTATTGGCGGCCATTTTCAGTATCGCGCGTGGATTGCGGTGAGCCAGAACTATAACATTCAGCGCGCGAGCCAGAAAGATTATAGCGATAAATTTCCGGTGAAAGAAGAACAGATTAGCCTGGGCTGCCAGGATAGCAGCCTGAACACCGAACAGCTGCTGAACATGATGGATGATAGCCAGCTGGTGCAGATTGTGCGCGGCCATCTGAACAAAAAACGCTATCTGCTGGTGTTTGATGATGTGTGGCGCACCGGCGCGTGGGAAAGCCTGAACATTGCGCTGCCGCCGGGCAAAGAAGGCAGCCGCGTGATTGTGACCACCCGCATTGAAGAAGTGGCGATTACCAGCTGCAGCCGCCATCAGTTTATTTTTAAAGTGAGCCCGCTGAGCAGCCAGCTGAGCTGGGAACTGCTGTGCCGCCGCGTGTTTAAAGTGCCGATGTATAGCTGCCCGCCGGAACTGGAAGAATATCTGCGCCGCACCATTATTGTGCTGGGCCTGCCGCTGGCGTGG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein, partial [Curcuma zedoaria].

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIQRASQKDYSDKFPVKEEQISLGCQDSSLNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAITSCSRHQFIFKVSPLSSQLSWELLCRRVFKVPMYSCPPELEEYLRRTIIVLGLPLAW


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-188 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIQRASQKDYSDKFPVKEEQISLGCQDSSLNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAITSCSRHQFIFKVSPLSSQLSWELLCRRVFKVPMYSCPPELEEYLRRTIIVLGLPLA

HMMPfam: PF00931
IPR002182
1-188 NB-ARC,NBS
NB-ARC

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIQRASQKDYSDKFPVKEEQISLGCQDSSLNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAITSCSRHQFIFKVSPLSSQLSWELLCRRVFKVPMYSCPPELEEYLRRTIIVLGLPLA

HMMPanther: PTHR11017:SF126
1-188 PTHR11017:SF126,OS11G0237600 PROTEIN

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIQRASQKDYSDKFPVKEEQISLGCQDSSLNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAITSCSRHQFIFKVSPLSSQLSWELLCRRVFKVPMYSCPPELEEYLRRTIIVLGLPLA

superfamily: SSF52540
1-177 SSF52540

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIQRASQKDYSDKFPVKEEQISLGCQDSSLNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAITSCSRHQFIFKVSPLSSQLSWELLCRRVFKVPMYSCPPELEEYLR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox