PRGDB00186702 ()

From PRG Wiki
Jump to: navigation, search
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 363548135 (JN426972)
Gene Class NL
Domain Type NBS, LRR
Gene Species Curcuma aromatica

Comment?

Curcuma aromatica clone Cap22 NBS-LRR disease resistance protein gene, partial cds.

DNA Sequence

GGCGGCGTGGGCAAAACCACCCTGGCGAAAATTGTGTATGATAAAACCGCGATTATTGGCGGCCATTTTCAGTATCGCGCGTGGATTGCGGTGAGCCAGAACTATAACATTAAAGAACTGCTGAAAAAAATTATTCGCCAGATTAGCGTGAAAGAAGAACAGAACACCGAACAGCTGCTGAACATGATGGATGATAGCCAGCTGGTGCAGATTGTGCGCGGCCATCTGAACAAAAAACGCTATCTGCTGGTGTTTGATGATGTGTGGCGCACCGGCGCGTGGGAAAGCCTGAACATTGCGCTGCCGCCGGGCAAAGAAGGCAGCCGCGTGATTGTGACCACCCGCATTGAAGAAGTGGCGATTCCGAGCTGCTATCGCCATCAGTTTATTTTTAAAGTGAGCCCGAGCAGCTATCAGCTGAGCTGGGAACTGCTGTGCCGCCGCGTGTTTAAAGTGCCGGATTATAGCTGCCCGCCGGAACTGGAAGAATATCTGCGCCGCACCATTATTGTGCTGGGCCTGCCGCTGGCG


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein NBS-LRR disease resistance protein, partial [Curcuma aromatica].

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAIPSCYRHQFIFKVSPSSYQLSWELLCRRVFKVPDYSCPPELEEYLRRTIIVLGLPLA


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
1-177 NB-ARC,NBS
NB-ARC

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAIPSCYRHQFIFKVSPSSYQLSWELLCRRVFKVPDYSCPPELEEYLRRTIIVLGLPLA

superfamily: SSF52540
1-166 SSF52540

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAIPSCYRHQFIFKVSPSSYQLSWELLCRRVFKVPDYSCPPELEEYLR

HMMPanther: PTHR11017
1-177 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAIPSCYRHQFIFKVSPSSYQLSWELLCRRVFKVPDYSCPPELEEYLRRTIIVLGLPLA

HMMPanther: PTHR11017:SF126
1-177 PTHR11017:SF126,OS11G0237600 PROTEIN

GGVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAIPSCYRHQFIFKVSPSSYQLSWELLCRRVFKVPDYSCPPELEEYLRRTIIVLGLPLA

Gene3D: G3DSA:3.40.50.300
2-126 G3DSA:3.40.50.300

GVGKTTLAKIVYDKTAIIGGHFQYRAWIAVSQNYNIKELLKKIIRQISVKEEQNTEQLLNMMDDSQLVQIVRGHLNKKRYLLVFDDVWRTGAWESLNIALPPGKEGSRVIVTTRIEEVAIPSCYR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox