PRGDB00187544 (Zm.64769)

From PRG Wiki
Jump to: navigation, search
Zm.64769
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 21206848 (AY103770)
Gene Class Unknown
Domain Type
Gene Species Zea mays

Comment?

Zea mays PCO100327 mRNA sequence

DNA Sequence

GCACGAGGAAACGTCTAGATCGCTCGTCCGGTGTGGTCTCTGGACTTGCTTGCCGTTCACTTCTCTTCAGCGGCAGCGTGGCAAGGCAACGAGAGCAACGAAGAGTATTCAAACCGAAAACAATGGATCCGGTGCGGAAGAGCGTGTGCGTGACCGGCGCTGGCGGCTTCGTCGCGTCGGAGCTGGTGAAGCTCCTCCTCTCCCGGGGCCAATACGCGGTCCGCGGCACCGTGCGCGACCCTGGTGCTAGCAAGAATGCCCATCTCAAGGTGCTGGAAGGAGCTGAGGAAAGGTTGCAGCTTCTCAAGGCTGATCTGATGGACTACGACAGCATTGCATCAGCAGTTGCCGGCTGTGAGGGTGTCTTCCATGTAGCTAGCCCTGTCCTTTCCCATCGACCCTCCAACCCTGAGGTGGAGGTCATAGCTCCCGCTGTAATAGGTACAACCAATGTGTTAAAGGCTTGCTATGAGGCAAAAGTTAGGCGAGTTGTGGTGGTGTCTTCATGTGGAGCTGTGTATGCTAATCCTATTTATCCGAAGGTAAGGTGTTTGATGAAGACTGCTGGTCAGATGAGGATTACTGCAGGAAGAAGGAGGATTGGTATTTAGTTTCCAAAACACTGTCGGAACGAGAAGCTCTTGCTTTTGCAGCAAAAACAGGGCTGGACGTTGTAACTGTTTGTCCGTCATTAGTATTTGGACCCTTGATGCAGCCTACAGTAAATTTGAGCAGCGAAATGATCCTTAAATATTTCAAAGATCTCGAGACTGTTGAAAATGTACTCAGTAATATGGTGGATATTCGTGATGTTGCTGATGCTCTTCTTCTGACTTACGAAAAGCCAGAAGCGTCTGGACGATACATCTGCAGTTCACATGCAATAAAAATTTCTGATATGATAAACATACTGAAGACCATGTATCCGTCTTACCCTTATCCCAAAAATTTTGTGGAAGATGATGTCAACTCTGTATACAGCTCTGAGAAACTGCAGAAGCTGGGGTGGACCTTCAAGCCTATAGAGGAATCCCTCCGTGACACTGTTGAATCCTACAAGGCATTTGGCATCCTGAATTGAACATCCAACTAGGACTGTTTCCATCTGCTGTTGCCTCCGAACTCCTCCTGAATAATGTAGGCGCAGTTAAACAGCAGCAGCACTGCCGATCTCTTTATTTTTCAATATTGTTATCTAGTGGTTCAGGACCAAATAAGTAGGCCAGGTGCTGACTGTTGTATGGTTTGTGGCCTATTGTCGTTGCTAAAAACTAGAAATGCGCGTACTAATGTTGCATTGCTGCACTTGATTTGTTTGTCGTCaaaaaaaaaa


Protein sequences

Name Description Sequence
Zm.64769 translated coding region predicted by ESTScan from UniGene Zm.64769

XTRKRLDRSSGVVSGLACRSLLFSGSVARQREQRRVFKPKTMDPVRKSVCVTGAGGFVASELVKLLLSRGQYAVRGTVRDPGASKNAHLKVLEGAEERLQLLKADLMDYDSIASAVAGCEGVFHVASPVLSHRPSNPEVEVIAPAVIGTTNVLKACYEAKVRRVVVVSSCGAVYANPXLSEGKVFDEDCWSDEDYCRKKEDWYLVSKTLSEREALAFAAKTGLDVVTVCPSLVFGPLMQPTVNLSSEMILKYFKDLETVENVLSNMVDIRDVADALLLTYEKPEASGRYICSSHAIKISDMINILKTMYPSYPYPKNFVEDDVNSVYSSEKLQKLGWTFKPIEESLRDTVESYKAFGILN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10366
31-360 FAMILY NOT NAMED,NAD DEPENDENT EPIMERASE/DEHYDRATASE

REQRRVFKPKTMDPVRKSVCVTGAGGFVASELVKLLLSRGQYAVRGTVRDPGASKNAHLKVLEGAEERLQLLKADLMDYDSIASAVAGCEGVFHVASPVLSHRPSNPEVEVIAPAVIGTTNVLKACYEAKVRRVVVVSSCGAVYANPXLSEGKVFDEDCWSDEDYCRKKEDWYLVSKTLSEREALAFAAKTGLDVVTVCPSLVFGPLMQPTVNLSSEMILKYFKDLETVENVLSNMVDIRDVADALLLTYEKPEASGRYICSSHAIKISDMINILKTMYPSYPYPKNFVEDDVNSVYSSEKLQKLGWTFKPIEESLRDTVESYKAFGILN

HMMPanther: PTHR10366:SF74
31-360 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

REQRRVFKPKTMDPVRKSVCVTGAGGFVASELVKLLLSRGQYAVRGTVRDPGASKNAHLKVLEGAEERLQLLKADLMDYDSIASAVAGCEGVFHVASPVLSHRPSNPEVEVIAPAVIGTTNVLKACYEAKVRRVVVVSSCGAVYANPXLSEGKVFDEDCWSDEDYCRKKEDWYLVSKTLSEREALAFAAKTGLDVVTVCPSLVFGPLMQPTVNLSSEMILKYFKDLETVENVLSNMVDIRDVADALLLTYEKPEASGRYICSSHAIKISDMINILKTMYPSYPYPKNFVEDDVNSVYSSEKLQKLGWTFKPIEESLRDTVESYKAFGILN

superfamily: SSF51735
47-355 NAD(P)-binding Rossmann-fold domains

KSVCVTGAGGFVASELVKLLLSRGQYAVRGTVRDPGASKNAHLKVLEGAEERLQLLKADLMDYDSIASAVAGCEGVFHVASPVLSHRPSNPEVEVIAPAVIGTTNVLKACYEAKVRRVVVVSSCGAVYANPXLSEGKVFDEDCWSDEDYCRKKEDWYLVSKTLSEREALAFAAKTGLDVVTVCPSLVFGPLMQPTVNLSSEMILKYFKDLETVENVLSNMVDIRDVADALLLTYEKPEASGRYICSSHAIKISDMINILKTMYPSYPYPKNFVEDDVNSVYSSEKLQKLGWTFKPIEESLRDTVESYKA

Gene3D: G3DSA:3.40.50.720
IPR016040
47-308 no description
NAD(P)-binding domain

KSVCVTGAGGFVASELVKLLLSRGQYAVRGTVRDPGASKNAHLKVLEGAEERLQLLKADLMDYDSIASAVAGCEGVFHVASPVLSHRPSNPEVEVIAPAVIGTTNVLKACYEAKVRRVVVVSSCGAVYANPXLSEGKVFDEDCWSDEDYCRKKEDWYLVSKTLSEREALAFAAKTGLDVVTVCPSLVFGPLMQPTVNLSSEMILKYFKDLETVENVLSNMVDIRDVADALLLTYEKPEASGRYICSSHAIKISDMINILKTM

HMMPfam: PF01370
IPR001509
49-289 Epimerase
NAD-dependent epimerase/dehydratase

VCVTGAGGFVASELVKLLLSRGQYAVRGTVRDPGASKNAHLKVLEGAEERLQLLKADLMDYDSIASAVAGCEGVFHVASPVLSHRPSNPEVEVIAPAVIGTTNVLKACYEAKVRRVVVVSSCGAVYANPXLSEGKVFDEDCWSDEDYCRKKEDWYLVSKTLSEREALAFAAKTGLDVVTVCPSLVFGPLMQPTVNLSSEMILKYFKDLETVENVLSNMVDIRDVADALLLTYEKPEASGRY

Coil: coil
85-113 coiled-coil

KNAHLKVLEGAEERLQLLKADLMDYDSIA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox