PRGDB00187569 (Zm.24716)

From PRG Wiki
Jump to: navigation, search
Zm.24716
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 238006785 (BT084075)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Zea mays

Comment?

Zea mays full-length cDNA clone ZM_BFb0071H15 mRNA, complete cds

DNA Sequence

CTAATGTATTCACTTATGGTGAACTAAGGACGTCTACTGAAAATTTTAGTTCCAATAACCTTCTGGGTGAAGGAGGATATGGGTCAGTTTATAAGGGTAAATTAGCTGAAGGAAGGGTGGTGGCTGTAAAACAGTTATCTGAAACATCTCATCAAGGAAAACAACAATTTGCTGCCGAAATAGGAACTATTTCTCGAGTGCAACACCGTAATCTTGTGAAGTTGTACGGTTGCTGCCTTGAGGGAAATAAACCACTGTTGGTTTATGAGTATCTGGAGAATGGAAGCCTTGATAAAGCATTATTTGGAAGTGGGAGACTGAACCTAGACTGGCCAACACGCTTTGAGATATGTTTGGGCATTGCAAGAGGCATCGCTTATCTCCATGAAGAGTCTAGCATCCGTATTGTGCATAGGGACATAAAGGCTAGCAATATCTTGCTTGACGCAAATTTCAACCCTAAGATCTCAGATTTTGGGCTCGCCAAACTTTATGACGACAAGAAGACTCATGTCAGCACAAAAGTTGCGGGTACATTTGGTTATCTTGCACCTGAGTACGCCATGAGAGGTCATATGACCGAGAAAGTTGATGTGTTTGCATTTGGCATGGTCATATTGGAGACCTTAGCCGGAAGACCAAATTTTGACAATATGCTAGATGAAATTAAGGTTTATATATTAGAATGGGTCTGGCAACTGTACGAAGATAAGCACCCTCTGGACATGGTCGACCCCAAGCTCGAAGAATTCAACAGTGGCGAGGTGATCCGTGCCATCCACGTGGCCCTCCTCTGCACCCAGGGCTCGCCACACCAGCGTCCTTCCATGTCACGAGCGGTGTCGATGCTGGCGGGAGACGTGGAGGTGGGCGAGGTGGTGAACAAACCCAGTTACATCACGGAGTGGCAGATCAAGGGTGGCAACACCAGCAGCTTCATGAGCAACAATGTCAGTGGACAGTCGAGCATGGCACCAAGGTCGTCAGCCTCGCACACCTCGTCGCCGTTCTTGAACTCTGTCATCGAAGAAGGCTGGTGATTATTACCAAGTTCTGTCAAGCGAACGGACTGCTGCTTATAAATGCACGCTACAGAATGCTCTCTGGTCTCTGCCTCTGCACATATGCTGTGTAGGTTCTATGTTCCATTTTTTATACAAATGATAGATATATTGATTGCTAGGTCCATTTGCAAGAACTAAGGTGGTGTTTGTTTAAGGTTATAATTTGTCAATATTATATAATCCAACAACTTTTAAACTAAAGATTAGTTCAAAAGTTGTTGAATTATATAATCTAGACAGATTATAATCTAAAACAAACACCCCTAAGTCACGTTAGATATATAATTTTCCGCTATATCAAACAGATCCTTACGTTGTCTCCATTGGCTTTCTATTTTCTATTCCATCTTCTAATTCAAACTTCACTTTATGC


Protein sequences

Name Description Sequence
Zm.24716 translated coding region predicted by ESTScan from UniGene Zm.24716

XNVFTYGELRTSTENFSSNNLLGEGGYGSVYKGKLAEGRVVAVKQLSETSHQGKQQFAAEIGTISRVQHRNLVKLYGCCLEGNKPLLVYEYLENGSLDKALFGSGRLNLDWPTRFEICLGIARGIAYLHEESSIRIVHRDIKASNILLDANFNPKISDFGLAKLYDDKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGMVILETLAGRPNFDNMLDEIKVYILEWVWQLYEDKHPLDMVDPKLEEFNSGEVIRAIHVALLCTQGSPHQRPSMSRAVSMLAGDVEVGEVVNKPSYITEWQIKGGNTSSFMSNNVSGQSSMAPRSSASHTSSPFLNSVIEEGW

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
2-315 Protein kinase-like (PK-like)
Protein kinase-like domain

NVFTYGELRTSTENFSSNNLLGEGGYGSVYKGKLAEGRVVAVKQLSETSHQGKQQFAAEIGTISRVQHRNLVKLYGCCLEGNKPLLVYEYLENGSLDKALFGSGRLNLDWPTRFEICLGIARGIAYLHEESSIRIVHRDIKASNILLDANFNPKISDFGLAKLYDDKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGMVILETLAGRPNFDNMLDEIKVYILEWVWQLYEDKHPLDMVDPKLEEFNSGEVIRAIHVALLCTQGSPHQRPSMSRAVSMLAGDVEVGEVVNKPSYITEWQIKGGNTSSFMS

Gene3D: G3DSA:3.30.200.20
2-77 no description

NVFTYGELRTSTENFSSNNLLGEGGYGSVYKGKLAEGRVVAVKQLSETSHQGKQQFAAEIGTISRVQHRNLVKLYG

HMMPanther: PTHR24420:SF469
2-343 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

NVFTYGELRTSTENFSSNNLLGEGGYGSVYKGKLAEGRVVAVKQLSETSHQGKQQFAAEIGTISRVQHRNLVKLYGCCLEGNKPLLVYEYLENGSLDKALFGSGRLNLDWPTRFEICLGIARGIAYLHEESSIRIVHRDIKASNILLDANFNPKISDFGLAKLYDDKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGMVILETLAGRPNFDNMLDEIKVYILEWVWQLYEDKHPLDMVDPKLEEFNSGEVIRAIHVALLCTQGSPHQRPSMSRAVSMLAGDVEVGEVVNKPSYITEWQIKGGNTSSFMSNNVSGQSSMAPRSSASHTSSPFLNSVIE

HMMPanther: PTHR24420
2-343 FAMILY NOT NAMED,FAMILY NOT NAMED

NVFTYGELRTSTENFSSNNLLGEGGYGSVYKGKLAEGRVVAVKQLSETSHQGKQQFAAEIGTISRVQHRNLVKLYGCCLEGNKPLLVYEYLENGSLDKALFGSGRLNLDWPTRFEICLGIARGIAYLHEESSIRIVHRDIKASNILLDANFNPKISDFGLAKLYDDKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGMVILETLAGRPNFDNMLDEIKVYILEWVWQLYEDKHPLDMVDPKLEEFNSGEVIRAIHVALLCTQGSPHQRPSMSRAVSMLAGDVEVGEVVNKPSYITEWQIKGGNTSSFMSNNVSGQSSMAPRSSASHTSSPFLNSVIE

HMMSmart: SM00219
IPR020635
16-284 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FSSNNLLGEGGYGSVYKGKLAEGRVVAVKQLSETSHQGKQQFAAEIGTISRVQHRNLVKLYGCCLEGNKPLLVYEYLENGSLDKALFGSGRLNLDWPTRFEICLGIARGIAYLHEESSIRIVHRDIKASNILLDANFNPKISDFGLAKLYDDKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGMVILETLAGRPNFDNMLDEIKVYILEWVWQLYEDKHPLDMVDPKLEEFNSGEVIRAIHVALLCTQGSPHQRPSMSRAVSML

ProfileScan: PS50011
IPR000719
16-290 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSSNNLLGEGGYGSVYKGKLAEGRVVAVKQLSETSHQGKQQFAAEIGTISRVQHRNLVKLYGCCLEGNKPLLVYEYLENGSLDKALFGSGRLNLDWPTRFEICLGIARGIAYLHEESSIRIVHRDIKASNILLDANFNPKISDFGLAKLYDDKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGMVILETLAGRPNFDNMLDEIKVYILEWVWQLYEDKHPLDMVDPKLEEFNSGEVIRAIHVALLCTQGSPHQRPSMSRAVSMLAGDVEV

HMMSmart: SM00220
IPR002290
16-284 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FSSNNLLGEGGYGSVYKGKLAEGRVVAVKQLSETSHQGKQQFAAEIGTISRVQHRNLVKLYGCCLEGNKPLLVYEYLENGSLDKALFGSGRLNLDWPTRFEICLGIARGIAYLHEESSIRIVHRDIKASNILLDANFNPKISDFGLAKLYDDKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGMVILETLAGRPNFDNMLDEIKVYILEWVWQLYEDKHPLDMVDPKLEEFNSGEVIRAIHVALLCTQGSPHQRPSMSRAVSML

HMMPfam: PF00069
IPR000719
19-279 Pkinase,Ser-thr
Protein kinase, catalytic domain

NNLLGEGGYGSVYKGKLAEGRVVAVKQLSETSHQGKQQFAAEIGTISRVQHRNLVKLYGCCLEGNKPLLVYEYLENGSLDKALFGSGRLNLDWPTRFEICLGIARGIAYLHEESSIRIVHRDIKASNILLDANFNPKISDFGLAKLYDDKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGMVILETLAGRPNFDNMLDEIKVYILEWVWQLYEDKHPLDMVDPKLEEFNSGEVIRAIHVALLCTQGSPHQRPSMSR

PatternScan: PS00107
IPR017441
22-44 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGYGSVYKGKLAEGRVVAVK

Gene3D: G3DSA:1.10.510.10
78-283 no description

CCLEGNKPLLVYEYLENGSLDKALFGSGRLNLDWPTRFEICLGIARGIAYLHEESSIRIVHRDIKASNILLDANFNPKISDFGLAKLYDDKKTHVSTKVAGTFGYLAPEYAMRGHMTEKVDVFAFGMVILETLAGRPNFDNMLDEIKVYILEWVWQLYEDKHPLDMVDPKLEEFNSGEVIRAIHVALLCTQGSPHQRPSMSRAVSM

PatternScan: PS00108
IPR008271
136-148 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDIKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox