PRGDB00187683 (Gma.61211)

From PRG Wiki
Jump to: navigation, search
Gma.61211
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 212552159 (EU848489)
Gene Class RLK-GNK2
Domain Type Ser-Thr Kinase, GNK2
Gene Species Glycine max

Comment?

Glycine max receptor-like protein kinase mRNA, complete cds

DNA Sequence

ATGTTTCACACTGCATTCTGTGATAACAAGGAAGGGAACTACACAGCGAATAGCACCTACAACACCAACCTCAACACCCTTTTATCAAGTCTCTCTTCCCACACAGAAATTAACTATGGTTTCTACAACTTCTCATATGGTCAAAACCCAGACAAAGTAAACGCAATTGGGCTATGCAGAGGAGATGTTGAGCCACATGAGTGCCGCAGTTGCCTCAATGATTCCAGAGTCACAATTAAACAGTTTTGTCCAAACCAGAAAAAGGCACTTCTGTGGTTGAACACTAGCAAATGCATGTTGCGCTACTCACCCCGCTCGATATTTGGCATCATGGAAATTGAACCTAGCCAATCCTTGATGAACATAAACAATGTAACGGAACCGGATAAGTTCAGTCAAGCTCTGGCGAACTTAATGAGAAACCTCAAAGGTGTAGCCGCATCGGGTGACTCTCGTCGTAAGTATGCCACGGATAATGTAACTGCTTCAAGTTTTCAGACCATATATGGTATGGCAGAGTGCACCCCTGACTTGTCTGAGAAAGACTGCAATGACTGCTTGGATGGGGCTATCTCAAAAATCCCAACCTGTTGTCAGGACAAGATAGGTGGTAGAGTTCTTAGACCAAGTTGTAATATTAGATTTGAAAGCGCAAGCTTCTACGAAAATACGCCTATTTTAAACCCAGATGTACCACCACCATCTCCAGCAGTAGCAATTCCTCCCTCCATCAATAGCACTTCCCCAAAAGTTAAACAACATGAAGATGATGATGAAATTGAAATTGCTCAGTCATTGCAATTCAACTTTGACACAATAAGAGTTGCTACAGAAGACTTCTCTGATTCTAATAAACTTGGACAGGGTGGATTTGGAGCAGTTTACAGGGGCAGGCTCTCCGATGGACAGATGATTGCAGTCAAAAGATTGTCAAGAGAATCCAGCCAAGGAGATACGGAATTTAAGAATGAAGTGCTTTTAGTGGCCAAGCTTCAGCACCGAAATTTAGTTAGGCTACTTGGTTTCTGCTTGGAAGGAAAAGAAAGGCTACTCATCTATGAATATGTTCCCAATAAAAGCCTTGATTATTTCATATTTGGTTCAGGACAAAGACTAAATATTCACATACCACTAAAACTCATGGCTGTATATGCAGATCCAACCAAGAAAGCACAATTGAATTGGGAAATGCGATACAAAATCATTACAGGTGTTGCGCGAGGCCTTCTCTACCTTCATGAAGATTCTCATCTGCGCATTATACATCGTGATCTGAAAGCAAGTAACATACTCTTAAACGAAGAGATGAATCCAAAGATAGCAGATTTTGGCATGGCAAGACTGGTTTTAATGGATCAAACTCAAGCAAATACAAATAGAATTGTTGGAACCTATGGATATATGGCACCTGAGTATGCAATGCATGGACAATTTTCAATGAAATCAGATGTCTTTAGTTTTGGTGTACTGGTTCTTGAGATCATAAGCGGCCATAAAAACAGTGGCATTCGTCATGGGGAGAATGTAGAGGATCTACTGAGCTTCATAGGTGGTAGAGTTCTTACTCCGAGTTGTAGTATTAGATACGAAAATTACAGCTTCTACGAACCTACGCCAATGTTATACCCACCATCCACACTGAATACTTCGTCCACCAATAGCACTTCTTCACAAGGGTTGGGTTGGAACCGGGTTAGGACGACCCGGCCCACCCTGCATTTAGGAATCAAGGTTGAAATAACCCTAGATGACTTAAATCCTGCAACGGTTTGGGAAACTACCACAAAGGGTGACACAAATGTCAAATGGCACCTTAGGATTGATCCTTGA


Protein sequences

Name Description Sequence
Gma.61211 translated coding region predicted by ESTScan from UniGene Gma.61211

MFHTAFCDNKEGNYTANSTYNTNLNTLLSSLSSHTEINYGFYNFSYGQNPDKVNAIGLCRGDVEPHECRSCLNDSRVTIKQFCPNQKKALLWLNTSKCMLRYSPRSIFGIMEIEPSQSLMNINNVTEPDKFSQALANLMRNLKGVAASGDSRRKYATDNVTASSFQTIYGMAECTPDLSEKDCNDCLDGAISKIPTCCQDKIGGRVLRPSCNIRFESASFYENTPILNPDVPPPSPAVAIPPSINSTSPKVKQHEDDDEIEIAQSLQFNFDTIRVATEDFSDSNKLGQGGFGAVYRGRLSDGQMIAVKRLSRESSQGDTEFKNEVLLVAKLQHRNLVRLLGFCLEGKERLLIYEYVPNKSLDYFIFGSGQRLNIHIPLKLMAVYADPTKKAQLNWEMRYKIITGVARGLLYLHEDSHLRIIHRDLKASNILLNEEMNPKIADFGMARLVLMDQTQANTNRIVGTYGYMAPEYAMHGQFSMKSDVFSFGVLVLEIISGHKNSGIRHGENVEDLLSFIGGRVLTPSCSIRYENYSFYEPTPMLYPPSTLNTSSTNSTSSQGLGWNRVRTTRPTLHLGIKVEITLDDLNPATVWETTTKGDTNVKWHLRIDP

Domains

Domain Start-End Description Sequence

ProfileScan: PS51473
IPR002902
2-107 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

FHTAFCDNKEGNYTANSTYNTNLNTLLSSLSSHTEINYGFYNFSYGQNPDKVNAIGLCRGDVEPHECRSCLNDSRVTIKQFCPNQKKALLWLNTSKCMLRYSPRSI

HMMPfam: PF01657
IPR002902
6-104 Stress-antifung
Gnk2-homologous domain

FCDNKEGNYTANSTYNTNLNTLLSSLSSHTEINYGFYNFSYGQNPDKVNAIGLCRGDVEPHECRSCLNDSRVTIKQFCPNQKKALLWLNTSKCMLRYSP

HMMPanther: PTHR24420:SF430
108-516 PTHR24420:SF430,SUBFAMILY NOT NAMED

FGIMEIEPSQSLMNINNVTEPDKFSQALANLMRNLKGVAASGDSRRKYATDNVTASSFQTIYGMAECTPDLSEKDCNDCLDGAISKIPTCCQDKIGGRVLRPSCNIRFESASFYENTPILNPDVPPPSPAVAIPPSINSTSPKVKQHEDDDEIEIAQSLQFNFDTIRVATEDFSDSNKLGQGGFGAVYRGRLSDGQMIAVKRLSRESSQGDTEFKNEVLLVAKLQHRNLVRLLGFCLEGKERLLIYEYVPNKSLDYFIFGSGQRLNIHIPLKLMAVYADPTKKAQLNWEMRYKIITGVARGLLYLHEDSHLRIIHRDLKASNILLNEEMNPKIADFGMARLVLMDQTQANTNRIVGTYGYMAPEYAMHGQFSMKSDVFSFGVLVLEIISGHKNSGIRHGENVEDLLSFI

HMMPanther: PTHR24420
108-516 PTHR24420,FAMILY NOT NAMED

FGIMEIEPSQSLMNINNVTEPDKFSQALANLMRNLKGVAASGDSRRKYATDNVTASSFQTIYGMAECTPDLSEKDCNDCLDGAISKIPTCCQDKIGGRVLRPSCNIRFESASFYENTPILNPDVPPPSPAVAIPPSINSTSPKVKQHEDDDEIEIAQSLQFNFDTIRVATEDFSDSNKLGQGGFGAVYRGRLSDGQMIAVKRLSRESSQGDTEFKNEVLLVAKLQHRNLVRLLGFCLEGKERLLIYEYVPNKSLDYFIFGSGQRLNIHIPLKLMAVYADPTKKAQLNWEMRYKIITGVARGLLYLHEDSHLRIIHRDLKASNILLNEEMNPKIADFGMARLVLMDQTQANTNRIVGTYGYMAPEYAMHGQFSMKSDVFSFGVLVLEIISGHKNSGIRHGENVEDLLSFI

ProfileScan: PS51473
IPR002902
113-220 GNK2,Gnk2-homologous domain profile.
Gnk2-homologous domain

IEPSQSLMNINNVTEPDKFSQALANLMRNLKGVAASGDSRRKYATDNVTASSFQTIYGMAECTPDLSEKDCNDCLDGAISKIPTCCQDKIGGRVLRPSCNIRFESASF

HMMPfam: PF01657
IPR002902
124-218 Stress-antifung
Gnk2-homologous domain

NVTEPDKFSQALANLMRNLKGVAASGDSRRKYATDNVTASSFQTIYGMAECTPDLSEKDCNDCLDGAISKIPTCCQDKIGGRVLRPSCNIRFESA

superfamily: SSF56112
IPR011009
252-516 Kinase_like
Protein kinase-like domain

KQHEDDDEIEIAQSLQFNFDTIRVATEDFSDSNKLGQGGFGAVYRGRLSDGQMIAVKRLSRESSQGDTEFKNEVLLVAKLQHRNLVRLLGFCLEGKERLLIYEYVPNKSLDYFIFGSGQRLNIHIPLKLMAVYADPTKKAQLNWEMRYKIITGVARGLLYLHEDSHLRIIHRDLKASNILLNEEMNPKIADFGMARLVLMDQTQANTNRIVGTYGYMAPEYAMHGQFSMKSDVFSFGVLVLEIISGHKNSGIRHGENVEDLLSFI

Gene3D: G3DSA:3.30.200.20
267-342 G3DSA:3.30.200.20

QFNFDTIRVATEDFSDSNKLGQGGFGAVYRGRLSDGQMIAVKRLSRESSQGDTEFKNEVLLVAKLQHRNLVRLLGF

ProfileScan: PS50011
IPR000719
280-609 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDSNKLGQGGFGAVYRGRLSDGQMIAVKRLSRESSQGDTEFKNEVLLVAKLQHRNLVRLLGFCLEGKERLLIYEYVPNKSLDYFIFGSGQRLNIHIPLKLMAVYADPTKKAQLNWEMRYKIITGVARGLLYLHEDSHLRIIHRDLKASNILLNEEMNPKIADFGMARLVLMDQTQANTNRIVGTYGYMAPEYAMHGQFSMKSDVFSFGVLVLEIISGHKNSGIRHGENVEDLLSFIGGRVLTPSCSIRYENYSFYEPTPMLYPPSTLNTSSTNSTSSQGLGWNRVRTTRPTLHLGIKVEITLDDLNPATVWETTTKGDTNVKWHLRIDP

HMMPfam: PF07714
IPR001245
283-500 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

SNKLGQGGFGAVYRGRLSDGQMIAVKRLSRESSQGDTEFKNEVLLVAKLQHRNLVRLLGFCLEGKERLLIYEYVPNKSLDYFIFGSGQRLNIHIPLKLMAVYADPTKKAQLNWEMRYKIITGVARGLLYLHEDSHLRIIHRDLKASNILLNEEMNPKIADFGMARLVLMDQTQANTNRIVGTYGYMAPEYAMHGQFSMKSDVFSFGVLVLEIISGHKN

PatternScan: PS00107
IPR017441
286-308 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGQGGFGAVYRGRLSDGQMIAVK

Gene3D: G3DSA:1.10.510.10
343-500 G3DSA:1.10.510.10

CLEGKERLLIYEYVPNKSLDYFIFGSGQRLNIHIPLKLMAVYADPTKKAQLNWEMRYKIITGVARGLLYLHEDSHLRIIHRDLKASNILLNEEMNPKIADFGMARLVLMDQTQANTNRIVGTYGYMAPEYAMHGQFSMKSDVFSFGVLVLEIISGHKN

PatternScan: PS00108
IPR008271
420-432 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox