PRGDB00187934 (Ta.75558)

From PRG Wiki
Jump to: navigation, search
Ta.75558
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 29169325 (AY222610)
Gene Class CNL
Domain Type NBS, LRR, Others
Gene Species Triticum aestivum

Comment?

Triticum aestivum mla-like protein mRNA, complete cds

DNA Sequence

ATGCAGATTGTCATCGGTGCCATTGGCAACCTGCTTCCCAAGTTGGGGGATCTGCTCACGGAGGAGTTCAAGCTGCACAAGGAGTACAAGAAAAATTTTGAGGACCTCGACAAGGAGCTTGAGAGCATGAACCAAGCCCTCATCAAGATAGGTGAGGTGCCGGATGAGCAGCTCGACGACCAAGACAAGCTCTGGGCCGATGAGGTCAGAGAGCTCTCCTACATCATTGAGGATGTCGTCGACAAATTCCTCGTAGACGTTGATGGCATTCAGTCTGATGATAACGACCACAAATTTAAGGGGCTCATGCGGAGGACGATAGAGTTGTTGAAGAAAAACATCAAGAACATCCAAGAGCAACTCCAAAAGGTGGCTAATAGGCGTGACAGGAACAAGGTATTTATTCCTAATCCTACGCCACCAATTGCTATTGACCCTTGCCTTCGAGCTTTGTATGCAGAAGCAACAGAGCTAGTTGGCATCTATGGGAAGAGGGATCAGGAGCTCATGAGGTTGCTCTCCATGGAGGGTGATGATGCCTCTAACAAGAGACTGAAGAAGGTCTCCATTGTTGGATTTGGAGGGTTGGGCAAGACCACTCTTGCTAGAGCAATATACGACAAGATTAAAGATCTTGCGATGCTGGATGCCAARCAGCTTATTAAAAAGCTTCAAGAATTCCTAGAGAACAAAAGGTATCRCGTCATAATTGACGATATATGGGATGAAAAATTGTGGGGAGGCATCAACTTTGCTTTCTCCAACAGGAATAATCTAGGCAGTCGGCTAATCACCACAACCCGCATTGTCAGTGTCTCCAATTCATGTTGCTCGTCAGCCGATGATTCAATTTATAAAATGGAACCGCTTTCTACCGATGACTCCAGAAGGCTCTTCTACAAAAGAATATTTCCCAATGATAGTGGATGTCCAAATGAATTTGAACAAGTGTCTAAAGATATATTGAAGAAATGTGGTGGGGTACCACTAGCCATCATTACTATTGCTAGTGCTTTGACCAGTGGCCAGAAGATGAAACCAAAGCATGAGTGGGATATTCTGCTCCAGTCCCTTGGCTCTGGACTAACAGAAGATAACAGRCRAGAGGAGARGCGTAGAATACTATCTTTCAGCTATTATAATCTACCCTCTCATCTGAAAACTTGTCTACTGTACCTATGTATATATCCAGAAGATCGCGAGATTAATAGAGATAGACTCATATGGAAGTGGGTGGCCGAAGGATTTGTCCACCATGGAAATCAAGGGACTAGCCTGTTTTTGCTTGGATTAAATTACTTCAACCAGCTCATTAATAGAAGRARGATCCAGCCAATATATGATGATATAGGCCAGGTACATGCTTGCCGTGTACATGATATGGTTCTGGACCTTATCTGCAACTTGTCACATGAAGCAAAGTTTGTTAATGTATTGGATGGCACTGGGAATAGCATGTCTTCACAAAGTAATGTTCGTCGTTTGTCCCTTCAGAATAAAATGGAAGATCATCAAGCCAAGCCTCTCACAAATATCATGAGTATGTCACGAGTGAGGTCAATTACTATCTTTCCACCTGCTGTTAGTATCATGCCAGCTCTGTCAAGGTTTGAAGTTCTGTGTGTACTTGATATGTCGGACTGTAACCTTGGGGAAAGTAGCAGCCTGCAGCCTAACCTAAAGGGTGTTGGACACTTAATTCACCTAAGGTACCTAGGTCTATCAGGTACCAGAATTAGTAAACTCCCGGCTGAGATAGGAACCCTGCAGTTTCTGGAGGTGTTGGATCTTGGATACAATCATGAGCTAGATGAATTGCCTTCCACTCTTTTTAAATTGAGAAGATTAATCTACCTAAATGTTTCTCCCTATAAGGTGGTTCGAACTCTTGGTGTGTTGCAGAATATGACATCCATAGAAGTGTTGAGGGGGATCTTTGTCTCTCTGAACATTATTGCACAAGAGCTTGGCAAACTGGCAAGGCTGAGGGAGCTTCAGATTCGCTTCAAGGATGGTAGTTTGGATTTGTATGAATGTTTCGTGAAGTCTCTGTGCAACCTACATCAGATCGAAAGTCTAATTATTGATTGCAATTCCGAAGAAGCATCTTTTGAACTGATGGATCACTTGGGAGAATGCTGGGTGCCTCCTGTACATCTCCGCGAATTTGTGTCATACATGCCCAGCCAACTCTCTGCACTGCGAGGGTGGATAAAGAGAGACCCCTCGCATCTCTCGAACCTCTCCGAGTTAATCCTCACGTCAGTGAAGGAAGTGCAGCAGGAGGACGTGGAAATCATTGGGGGGTTGCTGTCCCTTCGACGTCTCCGCATATGGAGCACCCACCAAACACAGCGGCTGCTAGTCATCCGTGCAGATGGGTTCCGCTGTATGGTTGACTTTTACTTGAACTGTCGATCAGCAACGCAGATAATGTTTGAATTGGGAGCTTTGCCGAGGGCGGAATCAGTTTTGTTCAGCCTGGGCTTGCGGGTCGCGAAAGAGGATGGTAACTCTGGTTTCGACTTGGGCCTTCAGGGGAACCTGCTCTCCCTTCGGCGTGGTGTCCGGATTTGGATGTATTCTGGTGGAGCGAGGGTGGGGGAGGCAAAGGAAGCTACCCTGTAGACTGTAGCTGTGTCAATTTTTAGGCTTTCTCTAATCTGTAAATTGTTTGTCATGTAAAAGGAAGATAGAAATGGCGTAGCAAATTCTTTTCTGTCAAATATGCTGTGTAATTCTTTTTAAAAGCCAACGGAGTCTGTACCAGAGGCTTCACTAATAAATGGTTTTCTAGTCGGCaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ta.75558 translated coding region predicted by ESTScan from UniGene Ta.75558

MQIVIGAIGNLLPKLGDLLTEEFKLHKEYKKNFEDLDKELESMNQALIKIGEVPDEQLDDQDKLWADEVRELSYIIEDVVDKFLVDVDGIQSDDNDHKFKGLMRRTIELLKKNIKNIQEQLQKVANRRDRNKVFIPNPTPPIAIDPCLRALYAEATELVGIYGKRDQELMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAIYDKIKDLAMLDAXQLIKKLQEFLENKRYXVIIDDIWDEKLWGGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSADDSIYKMEPLSTDDSRRLFYKRIFPNDSGCPNEFEQVSKDILKKCGGVPLAIITIASALTSGQKMKPKHEWDILLQSLGSGLTEDNXXEEXRRILSFSYYNLPSHLKTCLLYLCIYPEDREINRDRLIWKWVAEGFVHHGNQGTSLFLLGLNYFNQLINRXXIQPIYDDIGQVHACRVHDMVLDLICNLSHEAKFVNVLDGTGNSMSSQSNVRRLSLQNKMEDHQAKPLTNIMSMSRVRSITIFPPAVSIMPALSRFEVLCVLDMSDCNLGESSSLQPNLKGVGHLIHLRYLGLSGTRISKLPAEIGTLQFLEVLDLGYNHELDELPSTLFKLRRLIYLNVSPYKVVRTLGVLQNMTSIEVLRGIFVSLNIIAQELGKLARLRELQIRFKDGSLDLYECFVKSLCNLHQIESLIIDCNSEEASFELMDHLGECWVPPVHLREFVSYMPSQLSALRGWIKRDPSHLSNLSELILTSVKEVQQEDVEIIGGLLSLRRLRIWSTHQTQRLLVIRADGFRCMVDFYLNCRSATQIMFELGALPRAESVLFSLGLRVAKEDGNSGFDLGLQGNLLSLRRGVRIWMYSGGARVGEAKEATL

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF126
13-858 OS11G0237600 PROTEIN,OS11G0237600 PROTEIN

PKLGDLLTEEFKLHKEYKKNFEDLDKELESMNQALIKIGEVPDEQLDDQDKLWADEVRELSYIIEDVVDKFLVDVDGIQSDDNDHKFKGLMRRTIELLKKNIKNIQEQLQKVANRRDRNKVFIPNPTPPIAIDPCLRALYAEATELVGIYGKRDQELMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAIYDKIKDLAMLDAXQLIKKLQEFLENKRYXVIIDDIWDEKLWGGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSADDSIYKMEPLSTDDSRRLFYKRIFPNDSGCPNEFEQVSKDILKKCGGVPLAIITIASALTSGQKMKPKHEWDILLQSLGSGLTEDNXXEEXRRILSFSYYNLPSHLKTCLLYLCIYPEDREINRDRLIWKWVAEGFVHHGNQGTSLFLLGLNYFNQLINRXXIQPIYDDIGQVHACRVHDMVLDLICNLSHEAKFVNVLDGTGNSMSSQSNVRRLSLQNKMEDHQAKPLTNIMSMSRVRSITIFPPAVSIMPALSRFEVLCVLDMSDCNLGESSSLQPNLKGVGHLIHLRYLGLSGTRISKLPAEIGTLQFLEVLDLGYNHELDELPSTLFKLRRLIYLNVSPYKVVRTLGVLQNMTSIEVLRGIFVSLNIIAQELGKLARLRELQIRFKDGSLDLYECFVKSLCNLHQIESLIIDCNSEEASFELMDHLGECWVPPVHLREFVSYMPSQLSALRGWIKRDPSHLSNLSELILTSVKEVQQEDVEIIGGLLSLRRLRIWSTHQTQRLLVIRADGFRCMVDFYLNCRSATQIMFELGALPRAESVLFSLGLRVAKEDGNSGFDLGLQGNLLSLRRGVRI

HMMPanther: PTHR11017
13-858 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PKLGDLLTEEFKLHKEYKKNFEDLDKELESMNQALIKIGEVPDEQLDDQDKLWADEVRELSYIIEDVVDKFLVDVDGIQSDDNDHKFKGLMRRTIELLKKNIKNIQEQLQKVANRRDRNKVFIPNPTPPIAIDPCLRALYAEATELVGIYGKRDQELMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAIYDKIKDLAMLDAXQLIKKLQEFLENKRYXVIIDDIWDEKLWGGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSADDSIYKMEPLSTDDSRRLFYKRIFPNDSGCPNEFEQVSKDILKKCGGVPLAIITIASALTSGQKMKPKHEWDILLQSLGSGLTEDNXXEEXRRILSFSYYNLPSHLKTCLLYLCIYPEDREINRDRLIWKWVAEGFVHHGNQGTSLFLLGLNYFNQLINRXXIQPIYDDIGQVHACRVHDMVLDLICNLSHEAKFVNVLDGTGNSMSSQSNVRRLSLQNKMEDHQAKPLTNIMSMSRVRSITIFPPAVSIMPALSRFEVLCVLDMSDCNLGESSSLQPNLKGVGHLIHLRYLGLSGTRISKLPAEIGTLQFLEVLDLGYNHELDELPSTLFKLRRLIYLNVSPYKVVRTLGVLQNMTSIEVLRGIFVSLNIIAQELGKLARLRELQIRFKDGSLDLYECFVKSLCNLHQIESLIIDCNSEEASFELMDHLGECWVPPVHLREFVSYMPSQLSALRGWIKRDPSHLSNLSELILTSVKEVQQEDVEIIGGLLSLRRLRIWSTHQTQRLLVIRADGFRCMVDFYLNCRSATQIMFELGALPRAESVLFSLGLRVAKEDGNSGFDLGLQGNLLSLRRGVRI

Coil: coil
26-47 coiled-coil

HKEYKKNFEDLDKELESMNQAL

Coil: coil
100-128 coiled-coil

KGLMRRTIELLKKNIKNIQEQLQKVANRR

superfamily: SSF52540
141-365 P-loop containing nucleoside triphosphate hydrolases

PIAIDPCLRALYAEATELVGIYGKRDQELMRLLSMEGDDASNKRLKKVSIVGFGGLGKTTLARAIYDKIKDLAMLDAXQLIKKLQEFLENKRYXVIIDDIWDEKLWGGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSADDSIYKMEPLSTDDSRRLFYKRIFPNDSGCPNEFEQVSKDILKKCGGVPLAIITIASALTSGQKMKPKHEWDILLQSLGSGLTED

Gene3D: G3DSA:3.40.50.300
182-240 no description

NKRLKKVSIVGFGGLGKTTLARAIYDKIKDLAMLDAXQLIKKLQEFLENKRYXVIIDDI

FPrintScan: PR00364
IPR000767
187-202 DISEASERSIST
Disease resistance protein

KVSIVGFGGLGKTTLA

HMMPfam: PF00931
IPR002182
216-421 NB-ARC,NBS
NB-ARC

DAXQLIKKLQEFLENKRYXVIIDDIWDEKLWGGINFAFSNRNNLGSRLITTTRIVSVSNSCCSSADDSIYKMEPLSTDDSRRLFYKRIFPNDSGCPNEFEQVSKDILKKCGGVPLAIITIASALTSGQKMKPKHEWDILLQSLGSGLTEDNXXEEXRRILSFSYYNLPSHLKTCLLYLCIYPEDREINRDRLIWKWVAEGFVHHGN

FPrintScan: PR00364
IPR000767
325-339 DISEASERSIST
Disease resistance protein

CGGVPLAIITIASAL

superfamily: SSF52540
365-475 P-loop containing nucleoside triphosphate hydrolases

DNXXEEXRRILSFSYYNLPSHLKTCLLYLCIYPEDREINRDRLIWKWVAEGFVHHGNQGTSLFLLGLNYFNQLINRXXIQPIYDDIGQVHACRVHDMVLDLICNLSHEAKF

superfamily: SSF52058
457-828 L domain-like,LRR

RVHDMVLDLICNLSHEAKFVNVLDGTGNSMSSQSNVRRLSLQNKMEDHQAKPLTNIMSMSRVRSITIFPPAVSIMPALSRFEVLCVLDMSDCNLGESSSLQPNLKGVGHLIHLRYLGLSGTRISKLPAEIGTLQFLEVLDLGYNHELDELPSTLFKLRRLIYLNVSPYKVVRTLGVLQNMTSIEVLRGIFVSLNIIAQELGKLARLRELQIRFKDGSLDLYECFVKSLCNLHQIESLIIDCNSEEASFELMDHLGECWVPPVHLREFVSYMPSQLSALRGWIKRDPSHLSNLSELILTSVKEVQQEDVEIIGGLLSLRRLRIWSTHQTQRLLVIRADGFRCMVDFYLNCRSATQIMFELGALPRAESVLFSL

FPrintScan: PR00364
IPR000767
587-603 DISEASERSIST
Disease resistance protein

GTLQFLEVLDLGYNHEL

Gene3D: G3DSA:3.80.10.10
738-779 no description

IKRDPSHLSNLSELILTSVKEVQQEDVEIIGGLLSLRRLRIW

Seg: seg
766-778 seg

IIGGLLSLRRLRI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox